• Gene id: 55800

Gene Summary

• Gene Symbol: SCN3B   Gene   UCSC   Ensembl
• Aliases: ATFB16, BRGDA7, HSA243396, SCNB3
• Gene name: sodium voltage-gated channel beta subunit 3
• Alternate names: sodium channel subunit beta-3, sodium channel, voltage-gated, type III, beta subunit, voltage-gated sodium channel beta-3 subunit,
• Gene location: 11q24.1 (123654606: 123629186)     Exons: 7     NC_000011.10
• Gene summary(Entrez): Voltage-gated sodium channels are transmembrane glycoprotein complexes composed of a large alpha subunit and one or more regulatory beta subunits. They are responsible for the generation and propagation of action potentials in neurons and muscle. This gen
• OMIM: 609190

Protein Summary

• Protein general information: Q9NY72  
  • Name: Sodium channel subunit beta 3
  • Length: 215  
  • Mass: 24702
  • Tissue specificity: Expressed in the atrium. {ECO
• Sequence:

  MPAFNRLFPLASLVLIYWVSVCFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIY
  EYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKTTRLIPLRVTEEAG
  EDFTSVVSEIMMYILLVFLTLWLLIEMIYCYRKVSKAEEAAQENASDYLAIPSENKENSAVPVEE

• Structural information:
  • Protein Domains: (32..15-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106   IPR027098  IPR027096  
  • Prosite: PS50835
  • PDB: 4L1D
  • PDBsum: 4L1D
  • STRING: ENSP00000376523
• Other Databases: GeneCards:  SCN3B  Malacards:  SCN3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0086091	regulation of heart rate by cardiac conduction	IBA	biological process
GO:0019871	sodium channel inhibitor activity	IBA	molecular function
GO:2000649	regulation of sodium ion transmembrane transporter activity	IBA	biological process
GO:0086005	ventricular cardiac muscle cell action potential	IBA	biological process
GO:0086002	cardiac muscle cell action potential involved in contraction	IBA	biological process
GO:0044325	ion channel binding	IBA	molecular function
GO:0001518	voltage-gated sodium channel complex	IBA	cellular component
GO:0001518	voltage-gated sodium channel complex	IEA	cellular component
GO:0006814	sodium ion transport	IEA	biological process
GO:0017080	sodium channel regulator activity	IEA	molecular function
GO:0005272	sodium channel activity	IEA	molecular function
GO:0006814	sodium ion transport	IEA	biological process
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030018	Z disc	IEA	cellular component
GO:0086015	SA node cell action potential	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019233	sensory perception of pain	IEA	biological process
GO:0010460	positive regulation of heart rate	IEA	biological process
GO:0044325	ion channel binding	IEA	molecular function
GO:0060371	regulation of atrial cardiac muscle cell membrane depolarization	IEA	biological process
GO:0061337	cardiac conduction	IEA	biological process
GO:0086005	ventricular cardiac muscle cell action potential	IEA	biological process
GO:0086006	voltage-gated sodium channel activity involved in cardiac muscle cell action potential	IEA	molecular function
GO:0006814	sodium ion transport	IEA	biological process
GO:0086006	voltage-gated sodium channel activity involved in cardiac muscle cell action potential	IDA	molecular function
GO:0044325	ion channel binding	IPI	molecular function
GO:0086006	voltage-gated sodium channel activity involved in cardiac muscle cell action potential	IMP	molecular function
GO:0017080	sodium channel regulator activity	IDA	molecular function
GO:0017080	sodium channel regulator activity	IMP	molecular function
GO:0001518	voltage-gated sodium channel complex	IDA	cellular component
GO:0001518	voltage-gated sodium channel complex	IDA	cellular component
GO:0010765	positive regulation of sodium ion transport	IDA	biological process
GO:0035725	sodium ion transmembrane transport	IDA	biological process
GO:0035725	sodium ion transmembrane transport	IDA	biological process
GO:0001518	voltage-gated sodium channel complex	TAS	cellular component
GO:0010460	positive regulation of heart rate	ISS	biological process
GO:0010765	positive regulation of sodium ion transport	IMP	biological process
GO:0060371	regulation of atrial cardiac muscle cell membrane depolarization	IMP	biological process
GO:0060373	regulation of ventricular cardiac muscle cell membrane depolarization	IMP	biological process
GO:0072659	protein localization to plasma membrane	IMP	biological process
GO:0086002	cardiac muscle cell action potential involved in contraction	IMP	biological process
GO:0086005	ventricular cardiac muscle cell action potential	IMP	biological process
GO:0086012	membrane depolarization during cardiac muscle cell action potential	IMP	biological process
GO:2000649	regulation of sodium ion transmembrane transporter activity	IMP	biological process
GO:0051899	membrane depolarization	IDA	biological process
GO:0086010	membrane depolarization during action potential	IDA	biological process
GO:0086010	membrane depolarization during action potential	IDA	biological process
GO:0030018	Z disc	ISS	cellular component
GO:0060048	cardiac muscle contraction	IMP	biological process
GO:0060048	cardiac muscle contraction	IMP	biological process
GO:0086010	membrane depolarization during action potential	IMP	biological process
GO:0086014	atrial cardiac muscle cell action potential	IMP	biological process
GO:0086015	SA node cell action potential	ISS	biological process
GO:0086091	regulation of heart rate by cardiac conduction	IMP	biological process
GO:0086091	regulation of heart rate by cardiac conduction	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0006814	sodium ion transport	NAS	biological process

Diseases

Associated diseases	References
Atrial fibrillation	KEGG:H00731
Brugada syndrome	KEGG:H00728
Atrial fibrillation	KEGG:H00731
Brugada syndrome	KEGG:H00728
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray