• Gene id: 5580

Gene Summary

• Gene Symbol: PRKCD   Gene   UCSC   Ensembl
• Aliases: ALPS3, CVID9, MAY1, PKCD, nPKC-delta
• Gene name: protein kinase C delta
• Alternate names: protein kinase C delta type, protein kinase C delta VIII, tyrosine-protein kinase PRKCD,
• Gene location: 3p21.1 (53161208: 53192716)     Exons: 22     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the protein kinase C family of serine- and threonine-specific protein kinases. The encoded protein is activated by diacylglycerol and is both a tumor suppressor and a positive regulator of cell cycle progres
• OMIM: 176977

Protein Summary

• Protein general information: Q05655  
  • Name: Protein kinase C delta type (EC 2.7.11.13) (Tyrosine protein kinase PRKCD) (EC 2.7.10.2) (nPKC delta) [Cleaved into: Protein kinase C delta type regulatory subunit; Protein kinase C delta type catalytic subunit (Sphingosine dependent protein kinase 1) (SD
  • Length: 676  
  • Mass: 77505
• Sequence:

  MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQIVLMR
  AAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQYFLEDVDCKQSMRSEDEAKFPTMNRRGAIKQ
  AKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERF
  NIDMPHRFKVHNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASR
  RSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSFGKVLLGELKGRGEYF
  AIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTKDHLFFVMEFLNGGDLMYHIQDKGRFELYRA
  TFYAAEIMCGLQFLHSKGIIYRDLKLDNVLLDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKY
  TFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIH
  PFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLE
  D

• Structural information:
  • Protein Domains: (1..10-)
    (/note="C2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (349..60-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (604..67-)
    (/note="AGC-kinase-C-terminal")
  • Interpro: IPR000961  IPR035892  IPR020454  IPR011009  IPR034667   IPR002219  IPR027436  IPR017892  IPR014376  IPR000719  IPR017441  IPR008271  
  • Prosite: PS51285 PS50004 PS00107 PS50011 PS00108 PS00479 PS50081
  • CDD: cd00029 cd05620
  • PDB: 1YRK 2YUU
  • PDBsum: 1YRK 2YUU
  • DIP: 29954
  • STRING: ENSP00000378217
• Other Databases: GeneCards:  PRKCD  Malacards:  PRKCD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006468	protein phosphorylation	IDA	biological process
GO:0008631	intrinsic apoptotic signaling pathway in response to oxidative stress	TAS	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0070301	cellular response to hydrogen peroxide	IDA	biological process
GO:0032147	activation of protein kinase activity	IDA	biological process
GO:0032956	regulation of actin cytoskeleton organization	IMP	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:1904385	cellular response to angiotensin	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0006915	apoptotic process	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0034351	negative regulation of glial cell apoptotic process	IMP	biological process
GO:0032930	positive regulation of superoxide anion generation	IMP	biological process
GO:0030837	negative regulation of actin filament polymerization	ISS	biological process
GO:0004697	protein kinase C activity	ISS	molecular function
GO:0090331	negative regulation of platelet aggregation	ISS	biological process
GO:0051490	negative regulation of filopodium assembly	ISS	biological process
GO:0042742	defense response to bacterium	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0004698	calcium-dependent protein kinase C activity	IEA	molecular function
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030168	platelet activation	TAS	biological process
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032615	interleukin-12 production	IEA	biological process
GO:0032613	interleukin-10 production	IEA	biological process
GO:0030837	negative regulation of actin filament polymerization	IEA	biological process
GO:0016363	nuclear matrix	IEA	cellular component
GO:0005911	cell-cell junction	IEA	cellular component
GO:0004697	protein kinase C activity	IEA	molecular function
GO:2001235	positive regulation of apoptotic signaling pathway	IEA	biological process
GO:0090331	negative regulation of platelet aggregation	IEA	biological process
GO:0051490	negative regulation of filopodium assembly	IEA	biological process
GO:0050732	negative regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	IEA	biological process
GO:0043560	insulin receptor substrate binding	IEA	molecular function
GO:0042742	defense response to bacterium	IEA	biological process
GO:0042100	B cell proliferation	IEA	biological process
GO:0016064	immunoglobulin mediated immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0019899	enzyme binding	IDA	molecular function
GO:0004699	calcium-independent protein kinase C activity	TAS	molecular function
GO:0043560	insulin receptor substrate binding	ISS	molecular function
GO:0050728	negative regulation of inflammatory response	IC	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0010469	regulation of signaling receptor activity	TAS	biological process
GO:0032091	negative regulation of protein binding	TAS	biological process
GO:0023021	termination of signal transduction	IMP	biological process
GO:0035307	positive regulation of protein dephosphorylation	IMP	biological process
GO:0043407	negative regulation of MAP kinase activity	IMP	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	ISS	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	TAS	biological process
GO:0050732	negative regulation of peptidyl-tyrosine phosphorylation	ISS	biological process
GO:0090398	cellular senescence	IMP	biological process
GO:2000304	positive regulation of ceramide biosynthetic process	IMP	biological process
GO:2000753	positive regulation of glucosylceramide catabolic process	IMP	biological process
GO:2000755	positive regulation of sphingomyelin catabolic process	IMP	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0042119	neutrophil activation	IDA	biological process
GO:0016572	histone phosphorylation	IDA	biological process
GO:0071447	cellular response to hydroperoxide	IDA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IDA	biological process
GO:0008047	enzyme activator activity	IDA	molecular function
GO:0006915	apoptotic process	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004672	protein kinase activity	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1900163	positive regulation of phospholipid scramblase activity	IMP	biological process
GO:0050821	protein stabilization	NAS	biological process
GO:2001022	positive regulation of response to DNA damage stimulus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0060326	cell chemotaxis	IMP	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0042307	positive regulation of protein import into nucleus	IMP	biological process
GO:0032079	positive regulation of endodeoxyribonuclease activity	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis
hsa04062	Chemokine signaling pathway
hsa04621	NOD-like receptor signaling pathway
hsa04140	Autophagy - animal
hsa04270	Vascular smooth muscle contraction
hsa04722	Neurotrophin signaling pathway
hsa04915	Estrogen signaling pathway
hsa04625	C-type lectin receptor signaling pathway
hsa04931	Insulin resistance
hsa04666	Fc gamma R-mediated phagocytosis
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04912	GnRH signaling pathway
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa04930	Type II diabetes mellitus
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Autoimmune lymphoproliferative syndromes	KEGG:H00108
Autoimmune lymphoproliferative syndromes	KEGG:H00108
Portal hypertension	PMID:17659678
Hypertension	PMID:10756122
Fatty liver disease	PMID:17596878
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray