• Gene id: 5579

Gene Summary

• Gene Symbol: PRKCB   Gene   UCSC   Ensembl
• Aliases: PKC-beta, PKCB, PKCI(2), PKCbeta, PRKCB1, PRKCB2
• Gene name: protein kinase C beta
• Alternate names: protein kinase C beta type, PKC-B, protein kinase C, beta 1 polypeptide,
• Gene location: 16p12.2-p12.1 (23835982: 24220610)     Exons: 9     NC_000016.10
• Gene summary(Entrez): Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in d
• OMIM: 176970

Protein Summary

• Protein general information: P05771  
  • Name: Protein kinase C beta type (PKC B) (PKC beta) (EC 2.7.11.13)
  • Length: 671  
  • Mass: 76869
• Sequence:

  MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVH
  KRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSL
  CGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNE
  TFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEE
  LRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKK
  DVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEI
  AIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWW
  AFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
  RYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV

• Structural information:
  • Protein Domains: (158..27-)
    (/note="C2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (342..60-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (601..67-)
    (/note="AGC-kinase-C-terminal")
  • Interpro: IPR000961  IPR000008  IPR035892  IPR034664  IPR020454   IPR011009  IPR002219  IPR017892  IPR000719  IPR017441  IPR014375  IPR008271  
  • Prosite: PS51285 PS50004 PS00107 PS50011 PS00108 PS00479 PS50081
  • CDD: cd00029 cd05616
  • PDB: 2I0E
  • PDBsum: 2I0E
  • DIP: 34187
  • STRING: ENSP00000305355
• Other Databases: GeneCards:  PRKCB  Malacards:  PRKCB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046872	metal ion binding	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0004697	protein kinase C activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0007165	signal transduction	NAS	biological process
GO:0004698	calcium-dependent protein kinase C activity	IEA	molecular function
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0045637	regulation of myeloid cell differentiation	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007077	mitotic nuclear envelope disassembly	TAS	biological process
GO:0030168	platelet activation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0005246	calcium channel regulator activity	IEA	molecular function
GO:0006816	calcium ion transport	IEA	biological process
GO:0006874	cellular calcium ion homeostasis	IEA	biological process
GO:0008091	spectrin	IEA	cellular component
GO:0030949	positive regulation of vascular endothelial growth factor receptor signaling pathway	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0050853	B cell receptor signaling pathway	IEA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0099171	presynaptic modulation of chemical synaptic transmission	IEA	biological process
GO:0099523	presynaptic cytosol	IEA	cellular component
GO:2000300	regulation of synaptic vesicle exocytosis	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0010829	negative regulation of glucose transmembrane transport	IEA	biological process
GO:0042113	B cell activation	IEA	biological process
GO:0044305	calyx of Held	IEA	cellular component
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0050861	positive regulation of B cell receptor signaling pathway	IEA	biological process
GO:0071322	cellular response to carbohydrate stimulus	IEA	biological process
GO:0042953	lipoprotein transport	TAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0010827	regulation of glucose transmembrane transport	IDA	biological process
GO:0004697	protein kinase C activity	IDA	molecular function
GO:0050681	androgen receptor binding	IDA	molecular function
GO:0042393	histone binding	IDA	molecular function
GO:0035403	histone kinase activity (H3-T6 specific)	IDA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0035408	histone H3-T6 phosphorylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0051092	positive regulation of NF-kappaB transcription factor activity	ISS	biological process
GO:0050853	B cell receptor signaling pathway	ISS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	ISS	biological process
GO:0030949	positive regulation of vascular endothelial growth factor receptor signaling pathway	ISS	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IMP	biological process
GO:0005080	protein kinase C binding	IPI	molecular function
GO:0050861	positive regulation of B cell receptor signaling pathway	ISS	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	ISS	biological process
GO:0045766	positive regulation of angiogenesis	ISS	biological process
GO:0042113	B cell activation	ISS	biological process
GO:0030374	nuclear receptor transcription coactivator activity	IMP	molecular function
GO:0010829	negative regulation of glucose transmembrane transport	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04010	MAPK signaling pathway
hsa05206	MicroRNAs in cancer
hsa04014	Ras signaling pathway
hsa04015	Rap1 signaling pathway
hsa05163	Human cytomegalovirus infection
hsa04020	Calcium signaling pathway
hsa04062	Chemokine signaling pathway
hsa04510	Focal adhesion
hsa05170	Human immunodeficiency virus 1 infection
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04150	mTOR signaling pathway
hsa04723	Retrograde endocannabinoid signaling
hsa05225	Hepatocellular carcinoma
hsa05017	Spinocerebellar ataxia
hsa04921	Oxytocin signaling pathway
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa04728	Dopaminergic synapse
hsa04724	Glutamatergic synapse
hsa04270	Vascular smooth muscle contraction
hsa04071	Sphingolipid signaling pathway
hsa04725	Cholinergic synapse
hsa04670	Leukocyte transendothelial migration
hsa04070	Phosphatidylinositol signaling system
hsa04935	Growth hormone synthesis, secretion and action
hsa04919	Thyroid hormone signaling pathway
hsa04726	Serotonergic synapse
hsa04650	Natural killer cell mediated cytotoxicity
hsa04916	Melanogenesis
hsa05231	Choline metabolism in cancer
hsa05032	Morphine addiction
hsa04727	GABAergic synapse
hsa04064	NF-kappa B signaling pathway
hsa04713	Circadian entrainment
hsa04925	Aldosterone synthesis and secretion
hsa04928	Parathyroid hormone synthesis, secretion and action
hsa04972	Pancreatic secretion
hsa04931	Insulin resistance
hsa04666	Fc gamma R-mediated phagocytosis
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04066	HIF-1 signaling pathway
hsa04662	B cell receptor signaling pathway
hsa04970	Salivary secretion
hsa04912	GnRH signaling pathway
hsa04911	Insulin secretion
hsa04540	Gap junction
hsa04012	ErbB signaling pathway
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa05146	Amoebiasis
hsa04971	Gastric acid secretion
hsa04918	Thyroid hormone synthesis
hsa04720	Long-term potentiation
hsa05031	Amphetamine addiction
hsa05214	Glioma
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa04961	Endocrine and other factor-regulated calcium reabsorption
hsa05140	Leishmaniasis
hsa05223	Non-small cell lung cancer
hsa04929	GnRH secretion
hsa04730	Long-term depression
hsa04370	VEGF signaling pathway
hsa04973	Carbohydrate digestion and absorption
hsa04960	Aldosterone-regulated sodium reabsorption
hsa05143	African trypanosomiasis
P06959	CCKR signaling map

Diseases

Associated diseases	References
Alzheimer's disease	PMID:8534418
Cardiomyopathy	PMID:9918525
lung non-small cell carcinoma	PMID:28422739
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq