• Gene id: 55787

Gene Summary

• Gene Symbol: TXLNG   Gene   UCSC   Ensembl
• Aliases: CXorf15, ELRG, FIAT, LSR5, TXLNGX
• Gene name: taxilin gamma
• Alternate names: gamma-taxilin, environmental LPS-responding, environmental lipopolysaccharide-responding gene protein, factor inhibiting ATF4-mediated transcription, factor inhibiting activating transcription factor 4 (ATF4)-mediated transcription, lipopolysaccharide specific,
• Gene location: Xp22.2 (16786431: 16844518)     Exons: 15     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of the taxilin family. The encoded protein binds to the C-terminal coiled-coil region of syntaxin family members 1A, 3A and 4A, and may play a role in intracellular vesicle trafficking. This gene is up-regulated by lipopolysacch
• OMIM: 300677

Protein Summary

• Protein general information: Q9NUQ3  
  • Name: Gamma taxilin (Environmental lipopolysaccharide responding gene protein) (Factor inhibiting ATF4 mediated transcription) (FIAT) (Lipopolysaccharide specific response protein 5)
  • Length: 528  
  • Mass: 60586
  • Tissue specificity: Ubiquitously expressed. Expressed at high level in heart and skeletal muscle. Expressed in brain, placenta, lung, liver, kidney and pancreas. {ECO
• Sequence:

  MATRVEEAARGRGGGAEEATEAGRGGRRRSPRQKFEIGTMEEAGICGLGVKADMLCNSQSNDILQHQGSNCGGTS
  NKHSLEEDEGSDFITENRNLVSPAYCTQESREEIPGGEARTDPPDGQQDSECNRNKEKTLGKEVLLLMQALNTLS
  TPEEKLAALCKKYADLLEESRSVQKQMKILQKKQAQIVKEKVHLQSEHSKAILARSKLESLCRELQRHNKTLKEE
  NMQQAREEEERRKEATAHFQITLNEIQAQLEQHDIHNAKLRQENIELGEKLKKLIEQYALREEHIDKVFKHKELQ
  QQLVDAKLQQTTQLIKEADEKHQREREFLLKEATESRHKYEQMKQQEVQLKQQLSLYMDKFEEFQTTMAKSNELF
  TTFRQEMEKMTKKIKKLEKETIIWRTKWENNNKALLQMAEEKTVRDKEYKALQIKLERLEKLCRALQTERNELNE
  KVEVLKEQVSIKAAIKAANRDLATPVMQPCTALDSHKELNTSSKRALGAHLEAEPKSQRSAVQKPPSTGSAPAIE
  SVD

• Structural information:
  • Interpro: IPR026183  
  • STRING: ENSP00000369465
• Other Databases: GeneCards:  TXLNG  Malacards:  TXLNG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051726	regulation of cell cycle	IBA	biological process
GO:0019905	syntaxin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0031965	nuclear membrane	IEA	cellular component
GO:0030500	regulation of bone mineralization	IEA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0010564	regulation of cell cycle process	IMP	biological process
GO:0051726	regulation of cell cycle	ISS	biological process
GO:0033613	activating transcription factor binding	IPI	molecular function
GO:0030500	regulation of bone mineralization	ISS	biological process
GO:0005829	cytosol	ISS	cellular component
GO:0008134	transcription factor binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)