• Gene id: 55781

Gene Summary

• Gene Symbol: RIOK2   Gene   UCSC   Ensembl
• Aliases: RIO2
• Gene name: RIO kinase 2
• Alternate names: serine/threonine-protein kinase RIO2,
• Gene location: 5q15 (97183246: 97160866)     Exons: 11     NC_000005.10

Protein Summary

• Protein general information: Q9BVS4  
  • Name: Serine/threonine protein kinase RIO2 (EC 2.7.11.1) (RIO kinase 2)
  • Length: 552  
  • Mass: 63283
• Sequence:

  MGKVNVAKLRYMSRDDFRVLTAVEMGMKNHEIVPGSLIASIASLKHGGCNKVLRELVKHKLIAWERTKTVQGYRL
  TNAGYDYLALKTLSSRQVVESVGNQMGVGKESDIYIVANEEGQQFALKLHRLGRTSFRNLKNKRDYHKHRHNVSW
  LYLSRLSAMKEFAYMKALYERKFPVPKPIDYNRHAVVMELINGYPLCQIHHVEDPASVYDEAMELIVKLANHGLI
  HGDFNEFNLILDESDHITMIDFPQMVSTSHPNAEWYFDRDVKCIKDFFMKRFSYESELFPTFKDIRREDTLDVEV
  SASGYTKEMQADDELLHPLGPDDKNIETKEGSEFSFSDGEVAEKAEVYGSENESERNCLEESEGCYCRSSGDPEQ
  IKEDSLSEESADARSFEMTEFNQALEEIKGQVVENNSVTEFSEEKNRTENYNRQDGQRVQGGVPAGSDEYEDECP
  HLIALSSLNREFRPFRDEENVGAMNQYRTRTLSITSSGSAVSCSTIPPELVKQKVKRQLTKQQKSAVRRRLQKGE
  ANIFTKQRRENMQNIKSSLEAASFWGE

• Structural information:
  • Protein Domains: (97..27-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000305"-)
  • Interpro: IPR011009  IPR030484  IPR015285  IPR000687  IPR018935   IPR036388  IPR036390  
  • Prosite: PS01245
  • CDD: cd05144
  • PDB: 5DHF 6FDM 6FDN 6FDO 6G18 6G51 6HK6
  • PDBsum: 5DHF 6FDM 6FDN 6FDO 6G18 6G51 6HK6
  • STRING: ENSP00000283109
• Other Databases: GeneCards:  RIOK2  Malacards:  RIOK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0004672	protein kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0030490	maturation of SSU-rRNA	IBA	biological process
GO:0030688	preribosome, small subunit precursor	IBA	cellular component
GO:0030688	preribosome, small subunit precursor	IDA	cellular component
GO:2000234	positive regulation of rRNA processing	IDA	biological process
GO:2000208	positive regulation of ribosomal small subunit export from nucleus	IMP	biological process
GO:0042274	ribosomal small subunit biogenesis	IMP	biological process
GO:0030071	regulation of mitotic metaphase/anaphase transition	IMP	biological process
GO:0046777	protein autophosphorylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IMP	cellular component
GO:0030490	maturation of SSU-rRNA	IMP	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881