• Gene id: 55776

Gene Summary

• Gene Symbol: SAYSD1   Gene   UCSC   Ensembl
• Aliases: C6orf64
• Gene name: SAYSVFN motif domain containing 1
• Alternate names: SAYSvFN domain-containing protein 1,
• Gene location: 6p21.2 (39115185: 39104062)     Exons: 8     NC_000006.12

Protein Summary

• Protein general information: Q9NPB0  
  • Name: SAYSvFN domain containing protein 1
  • Length: 183  
  • Mass: 20163
• Sequence:

  MEQRLAEFRAARKRAGLAAQPPAASQGAQTPGEKAEAAATLKAAPGWLKRFLVWKPRPASARAQPGLVQEAAQPQ
  GSTSETPWNTAIPLPSCWDQSFLTNITFLKVLLWLVLLGLFVELEFGLAYFVLSLFYWMYVGTRGPEEKKEGEKS
  AYSVFNPGCEAIQGTLTAEQLERELQLRPLAGR

• Structural information:
  • Interpro: IPR039159  IPR019387  
  • STRING: ENSP00000229903
• Other Databases: GeneCards:  SAYSD1  Malacards:  SAYSD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray