• Gene id: 55770

Gene Summary

• Gene Symbol: EXOC2   Gene   UCSC   Ensembl
• Aliases: SEC5, SEC5L1, Sec5p
• Gene name: exocyst complex component 2
• Alternate names: exocyst complex component 2, SEC5-like 1, exocyst complex component Sec5,
• Gene location: 6p25.3 (693140: 485137)     Exons: 34     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a component of the exocyst complex, a multi-protein complex essential for the polarized targeting of exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component
• OMIM: 606399

Protein Summary

• Protein general information: Q96KP1  
  • Name: Exocyst complex component 2 (Exocyst complex component Sec5)
  • Length: 924  
  • Mass: 104066
  • Tissue specificity: Widely expressed with highest levels in brain and placenta. {ECO
• Sequence:

  MSRSRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDII
  VTTKSGGRGTSTVSFKLLKPEKIGILDQSAVWVDEMNYYDMRTDRNKGIPPLSLRPANPLGIEIEKSKFSQKDLE
  MLFHGMSADFTSENFSAAWYLIENHSNTSFEQLKMAVTNLKRQANKKSEGSLAYVKGGLSTFFEAQDALSAIHQK
  LEADGTEKVEGSMTQKLENVLNRASNTADTLFQEVLGRKDKADSTRNALNVLQRFKFLFNLPLNIERNIQKGDYD
  VVINDYEKAKSLFGKTEVQVFKKYYAEVETRIEALRELLLDKLLETPSTLHDQKRYIRYLSDLHASGDPAWQCIG
  AQHKWILQLMHSCKEGYVKDLKGNPGLHSPMLDLDNDTRPSVLGHLSQTASLKRGSSFQSGRDDTWRYKTPHRVA
  FVEKLTKLVLSQLPNFWKLWISYVNGSLFSETAEKSGQIERSKNVRQRQNDFKKMIQEVMHSLVKLTRGALLPLS
  IRDGEAKQYGGWEVKCELSGQWLAHAIQTVRLTHESLTALEIPNDLLQTIQDLILDLRVRCVMATLQHTAEEIKR
  LAEKEDWIVDNEGLTSLPCQFEQCIVCSLQSLKGVLECKPGEASVFQQPKTQEEVCQLSINIMQVFIYCLEQLST
  KPDADIDTTHLSVDVSSPDLFGSIHEDFSLTSEQRLLIVLSNCCYLERHTFLNIAEHFEKHNFQGIEKITQVSMA
  SLKELDQRLFENYIELKADPIVGSLEPGIYAGYFDWKDCLPPTGVRNYLKEALVNIIAVHAEVFTISKELVPRVL
  SKVIEAVSEELSRLMQCVSSFSKNGALQARLEICALRDTVAVYLTPESKSSFKQALEALPQLSSGADKKLLEELL
  NKFKSSMHLQLTCFQAASSTMMKT

• Structural information:
  • Protein Domains: (8..9-)
    (/note="IPT/TIG"-)
  • Interpro: IPR029175  IPR039481  IPR013783  IPR014756  IPR002909  
  • DIP: 31795
  • STRING: ENSP00000230449
• Other Databases: GeneCards:  EXOC2  Malacards:  EXOC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016192	vesicle-mediated transport	IBA	biological process
GO:0006893	Golgi to plasma membrane transport	IBA	biological process
GO:0006887	exocytosis	IBA	biological process
GO:0000145	exocyst	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006893	Golgi to plasma membrane transport	IEA	biological process
GO:0000145	exocyst	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0006887	exocytosis	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:2000535	regulation of entry of bacterium into host cell	IMP	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0017160	Ral GTPase binding	IEA	molecular function
GO:0047485	protein N-terminus binding	IEA	molecular function
GO:0090543	Flemming body	IEA	cellular component
GO:0000145	exocyst	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0017160	Ral GTPase binding	IPI	molecular function
GO:0017160	Ral GTPase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04014	Ras signaling pathway
hsa05132	Salmonella infection

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray