• Gene id: 5577

Gene Summary

• Gene Symbol: PRKAR2B   Gene   UCSC   Ensembl
• Aliases: PRKAR2, RII-BETA
• Gene name: protein kinase cAMP-dependent type II regulatory subunit beta
• Alternate names: cAMP-dependent protein kinase type II-beta regulatory subunit, H_RG363E19.2, WUGSC:H_RG363E19.2, cAMP-dependent protein kinase type II-beta regulatory chain, protein kinase, cAMP-dependent, regulatory subunit type II beta, protein kinase, cAMP-dependent, regul,
• Gene location: 7q22.3 (107044704: 107161810)     Exons: 12     NC_000007.14
• Gene summary(Entrez): cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holo
• OMIM: 613844

SNPs

rs780798708

Strand:    Allele origin:   Allele change:   Mutation type: del

NC_000003.12   g.113380945_113380946del
NC_000003.11   g.113099792_113099793del
NM_018338.3   c.2005_2006del
NM_001164496.2   c.2005_2006del
NM_001164496.1   c.2005_2006del
NP_060808.2   p.Met669fs
NP_001157968.1   p.Met669fs|SEQ=[AT/-]|GENE=CFAP44

Protein Summary

• Protein general information: P31323  
  • Name: cAMP dependent protein kinase type II beta regulatory subunit
  • Length: 418  
  • Mass: 46302
  • Tissue specificity: Four types of regulatory chains are found
• Sequence:

  MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGDLGAAAGGGTPSKGVN
  FAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRIIHPKTDDQRNRLQEACK
  DILLFKNLDPEQMSQVLDAMFEKLVKDGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELA
  LMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDG
  EQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKPRAASAHAIGTVKCLA
  MDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA

• Structural information:
  • Interpro: IPR012198  IPR003117  IPR018490  IPR018488  IPR000595   IPR014710  
  • Prosite: PS00888 PS00889 PS50042
  • CDD: cd00038
  • DIP: 554
  • STRING: ENSP00000265717
• Other Databases: GeneCards:  PRKAR2B  Malacards:  PRKAR2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043197	dendritic spine	ISS	cellular component
GO:0043198	dendritic shaft	ISS	cellular component
GO:0005952	cAMP-dependent protein kinase complex	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0043949	regulation of cAMP-mediated signaling	IBA	biological process
GO:0010738	regulation of protein kinase A signaling	IBA	biological process
GO:0008603	cAMP-dependent protein kinase regulator activity	IBA	molecular function
GO:0031625	ubiquitin protein ligase binding	IDA	molecular function
GO:0005813	centrosome	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005952	cAMP-dependent protein kinase complex	IEA	cellular component
GO:0001932	regulation of protein phosphorylation	IEA	biological process
GO:0008603	cAMP-dependent protein kinase regulator activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0030552	cAMP binding	IEA	molecular function
GO:0008603	cAMP-dependent protein kinase regulator activity	TAS	molecular function
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0003091	renal water homeostasis	TAS	biological process
GO:0071377	cellular response to glucagon stimulus	TAS	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0010389	regulation of G2/M transition of mitotic cell cycle	TAS	biological process
GO:0034199	activation of protein kinase A activity	TAS	biological process
GO:0097546	ciliary base	TAS	cellular component
GO:0097711	ciliary basal body-plasma membrane docking	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097338	response to clozapine	IEA	biological process
GO:0045859	regulation of protein kinase activity	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0030552	cAMP binding	IEA	molecular function
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0008603	cAMP-dependent protein kinase regulator activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0043198	dendritic shaft	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0019901	protein kinase binding	IEA	molecular function
GO:0008603	cAMP-dependent protein kinase regulator activity	IEA	molecular function
GO:0007612	learning	IEA	biological process
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0098794	postsynapse	IEA	cellular component
GO:0097332	response to antipsychotic drug	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0005952	cAMP-dependent protein kinase complex	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098794	postsynapse	IEA	cellular component
GO:0097546	ciliary base	IEA	cellular component
GO:0005952	cAMP-dependent protein kinase complex	IEA	cellular component
GO:0004862	cAMP-dependent protein kinase inhibitor activity	IDA	molecular function
GO:0008603	cAMP-dependent protein kinase regulator activity	IDA	molecular function
GO:0034236	protein kinase A catalytic subunit binding	IPI	molecular function
GO:0034236	protein kinase A catalytic subunit binding	IPI	molecular function
GO:2000480	negative regulation of cAMP-dependent protein kinase activity	IDA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04910	Insulin signaling pathway

Diseases

Associated diseases	References
Granulosa cell tumor	PMID:11994539
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881