• Gene id: 55765

Gene Summary

• Gene Symbol: INAVA   Gene   UCSC   Ensembl
• Aliases: C1orf106
• Gene name: innate immunity activator
• Alternate names: innate immunity activator protein, uncharacterized protein C1orf106,
• Gene location: 1q32.1 (200891073: 200915741)     Exons: 12     NC_000001.11
• OMIM: 609809

Protein Summary

• Protein general information: Q3KP66  
  • Name: Innate immunity activator protein
  • Length: 663  
  • Mass: 72914
  • Tissue specificity: Highly expressed in intestinal myeloid-derived cells and expressed in monocyte-derived macrophages upon induction by PRR activation. {ECO
• Sequence:

  MLQMPKLNEIPPGRAGRREARGEGRWPGQTGPEAARLEWRAQGQAGGARAPWDSWGSSRLPTQPGPGWSRCPPSL
  LCALSFQKSTMESKDEVSDTDSGIILQSGPDSPVSPMKELTHAVHKQQRALEARLEACLEELRRLCLREAELTGT
  LPAEYPLKPGEKAPKVRRRIGAAYKLDDWALHREDPLSSLERQLALQLQITEAARRLCLEENLSRQARRQRKHSM
  LQEEKKLQELQRCLVERRRNSEPPPAAALPLGRELSASDDSSLSDGLLLEEEESQVPKPPPESPAPPSRPLPPQT
  LEGLQPTGPEAGSPERAPVQNSPWKETSLDHPYEKPRKSSEPWSESSSPATTPQDGPSASSLWLLEPASYHVVPI
  RGVPGQWQGRTSAPATPEIQGRRGQSQSLRVDSFRAGPEGRGRSAFPRRRPTHYTVTVPDSCFPATKPPLPHAAC
  HSCSEDSGSDVSSISHPTSPGSSSPDISFLQPLSPPKTHRHRGAWVPAGSRELVAHHPKLLLPPGYFPAGRYVVV
  AESPLPPGEWELRRAAPGPAYEEEGTPLRYQRLVPSRSRIVRTPSLKDSPAGRGLSKAAVSEELKWWHERARLRS
  TRPHSLDRQGAFRVRSLPLGREGFGRALGPRAQVPTVCVLRRSPDGAPVQVFVPEKGEIISQV

• Structural information:
  • Interpro: IPR021774  IPR039106  
  • STRING: ENSP00000392105
• Other Databases: GeneCards:  INAVA  Malacards:  INAVA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031398	positive regulation of protein ubiquitination	IBA	biological process
GO:0034334	adherens junction maintenance	IBA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0045087	innate immune response	IMP	biological process
GO:0032755	positive regulation of interleukin-6 production	IMP	biological process
GO:0032874	positive regulation of stress-activated MAPK cascade	IMP	biological process
GO:0032494	response to peptidoglycan	IMP	biological process
GO:0002367	cytokine production involved in immune response	IMP	biological process
GO:0000187	activation of MAPK activity	IMP	biological process
GO:0032733	positive regulation of interleukin-10 production	IMP	biological process
GO:0005634	nucleus	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:1903409	reactive oxygen species biosynthetic process	IMP	biological process
GO:0005737	cytoplasm	IMP	cellular component
GO:0070431	nucleotide-binding oligomerization domain containing 2 signaling pathway	IMP	biological process
GO:0032495	response to muramyl dipeptide	IMP	biological process
GO:0002221	pattern recognition receptor signaling pathway	IMP	biological process
GO:0032731	positive regulation of interleukin-1 beta production	IMP	biological process
GO:0031398	positive regulation of protein ubiquitination	IMP	biological process
GO:0060729	intestinal epithelial structure maintenance	ISS	biological process
GO:0034334	adherens junction maintenance	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray