• Gene id: 55763

Gene Summary

• Gene Symbol: EXOC1   Gene   UCSC   Ensembl
• Aliases: BM-102, SEC3, SEC3L1, SEC3P
• Gene name: exocyst complex component 1
• Alternate names: exocyst complex component 1, SEC3-like 1, exocyst complex component Sec3,
• Gene location: 4q12 (55853647: 55905085)     Exons: 21     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and f
• OMIM: 607879

Protein Summary

• Protein general information: Q9NV70  
  • Name: Exocyst complex component 1 (Exocyst complex component Sec3)
  • Length: 894  
  • Mass: 101982
• Sequence:

  MTAIKHALQRDIFTPNDERLLSIVNVCKAGKKKKNCFLCATVTTERPVQVKVVKVKKSDKGDFYKRQIAWALRDL
  AVVDAKDAIKENPEFDLHFEKIYKWVASSTAEKNAFISCIWKLNQRYLRKKIDFVNVSSQLLEESVPSGENQSVT
  GGDEEVVDEYQELNAREEQDIEIMMEGCEYAISNAEAFAEKLSRELQVLDGANIQSIMASEKQVNILMKLLDEAL
  KEVDQIELKLSSYEEMLQSVKEQMDQISESNHLIHLSNTNNVKLLSEIEFLVNHMDLAKGHIKALQEGDLASSRG
  IEACTNAADALLQCMNVALRPGHDLLLAVKQQQQRFSDLRELFARRLASHLNNVFVQQGHDQSSTLAQHSVELTL
  PNHHPFHRDLLRYAKLMEWLKSTDYGKYEGLTKNYMDYLSRLYEREIKDFFEVAKIKMTGTTKESKKFATLPRKE
  SAVKQETESLHGSSGKLTGSTSSLNKLSVQSSGNRRSQSSSLLDMGNMSASDLDVADRTKFDKIFEQVLSELEPL
  CLAEQDFISKFFKLQQHQSMPGTMAEAEDLDGGTLSRQHNCGTPLPVSSEKDMIRQMMIKIFRCIEPELNNLIAL
  GDKIDSFNSLYMLVKMSHHVWTAQNVDPASFLSTTLGNVLVTVKRNFDKCISNQIRQMEEVKISKKSKVGILPFV
  AEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFVNVEKVANESQKTPRDVVMMENFHHIFATLSRLKISCLEA
  EKKEAKQKYTDHLQSYVIYSLGQPLEKLNHFFEGVEARVAQGIREEEVSYQLAFNKQELRKVIKEYPGKEVKKGL
  DNLYKKVDKHLCEEENLLQVVWHSMQDEFIRQYKHFEGLIARCYPGSGVTMEFTIQDILDYCSSIAQSH

• Structural information:
  • Interpro: IPR028258  IPR019160  
  • DIP: 37579
  • STRING: ENSP00000370695
• Other Databases: GeneCards:  EXOC1  Malacards:  EXOC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0051601	exocyst localization	IBA	biological process
GO:0017049	GTP-Rho binding	IBA	molecular function
GO:0006887	exocytosis	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IBA	molecular function
GO:0000145	exocyst	IBA	cellular component
GO:0006893	Golgi to plasma membrane transport	IBA	biological process
GO:0000145	exocyst	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090543	Flemming body	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0048015	phosphatidylinositol-mediated signaling	IDA	biological process
GO:0098592	cytoplasmic side of apical plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0000145	exocyst	NAS	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0006887	exocytosis	NAS	biological process
GO:0050714	positive regulation of protein secretion	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)