• Gene id: 5576

Gene Summary

• Gene Symbol: PRKAR2A   Gene   UCSC   Ensembl
• Aliases: PKR2, PRKAR2
• Gene name: protein kinase cAMP-dependent type II regulatory subunit alpha
• Alternate names: cAMP-dependent protein kinase type II-alpha regulatory subunit, cAMP-dependent protein kinase regulatory subunit RII alpha, protein kinase A, RII-alpha subunit, protein kinase, cAMP-dependent, regulatory subunit type II alpha,
• Gene location: 3p21.31 (48847873: 48744600)     Exons: 15     NC_000003.12
• Gene summary(Entrez): cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holo
• OMIM: 176910

Protein Summary

• Protein general information: P13861  
  • Name: cAMP dependent protein kinase type II alpha regulatory subunit
  • Length: 404  
  • Mass: 45518
  • Tissue specificity: Four types of regulatory chains are found
• Sequence:

  MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAK
  GDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQ
  VLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATS
  EGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYI
  IESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCM
  DIMKRNISHYEEQLVKMFGSSVDLGNLGQ

• Structural information:
  • Interpro: IPR012198  IPR003117  IPR018490  IPR018488  IPR000595   IPR014710  
  • Prosite: PS00888 PS00889 PS50042
  • CDD: cd00038
  • PDB: 2IZX 2KYG 4ZP3 5H78 5XBY
  • PDBsum: 2IZX 2KYG 4ZP3 5H78 5XBY
  • DIP: 552
  • STRING: ENSP00000265563
• Other Databases: GeneCards:  PRKAR2A  Malacards:  PRKAR2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008603	cAMP-dependent protein kinase regulator activity	IBA	molecular function
GO:0010738	regulation of protein kinase A signaling	IBA	biological process
GO:0043949	regulation of cAMP-mediated signaling	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0005952	cAMP-dependent protein kinase complex	IBA	cellular component
GO:0031625	ubiquitin protein ligase binding	IDA	molecular function
GO:0005813	centrosome	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005952	cAMP-dependent protein kinase complex	IEA	cellular component
GO:0001932	regulation of protein phosphorylation	IEA	biological process
GO:0008603	cAMP-dependent protein kinase regulator activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0030552	cAMP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0003091	renal water homeostasis	TAS	biological process
GO:0071377	cellular response to glucagon stimulus	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0034199	activation of protein kinase A activity	TAS	biological process
GO:0097546	ciliary base	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034236	protein kinase A catalytic subunit binding	IPI	molecular function
GO:0034236	protein kinase A catalytic subunit binding	IPI	molecular function
GO:0004862	cAMP-dependent protein kinase inhibitor activity	IDA	molecular function
GO:0008603	cAMP-dependent protein kinase regulator activity	IDA	molecular function
GO:2000480	negative regulation of cAMP-dependent protein kinase activity	IDA	biological process
GO:0031588	nucleotide-activated protein kinase complex	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0044853	plasma membrane raft	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005952	cAMP-dependent protein kinase complex	IDA	cellular component
GO:0005930	axoneme	IDA	colocalizes with
GO:0005925	focal adhesion	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0034236	protein kinase A catalytic subunit binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0008603	cAMP-dependent protein kinase regulator activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04910	Insulin signaling pathway

Diseases

Associated diseases	References
congestive heart failure	PMID:10830164
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray