• Gene id: 55752

Gene Summary

• Gene Symbol: SEPTIN11   Gene   UCSC   Ensembl
• Aliases: SEPT11
• Gene name: septin 11
• Alternate names: septin-11, epididymis secretory sperm binding protein,
• Gene location: 4q21.1 (76949751: 77040153)     Exons: 13     NC_000004.12
• Gene summary(Entrez): SEPT11 belongs to the conserved septin family of filament-forming cytoskeletal GTPases that are involved in a variety of cellular functions including cytokinesis and vesicle trafficking (Hanai et al., 2004 [PubMed 15196925]; Nagata et al., 2004 [PubMed 15
• OMIM: 618311

Protein Summary

• Protein general information: Q9NVA2  
  • Name: Septin 11
  • Length: 429  
  • Mass: 49398
  • Tissue specificity: Widely expressed, except in leukocytes. {ECO
• Sequence:

  MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNE
  PGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLFNYHDTRIHAC
  LYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQIYQFPTDEETVAEIN
  ATMSVHLPFAVVGSTEEVKIGNKMAKARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRC
  KLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQ
  EEKKKVEDKKKELEEEVNNFQKKKAAAQLLQSQAQQSGAQQTKKDKDKKNASFT

• Structural information:
  • Protein Domains: (38..30-)
    (/note="Septin-type-G)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01056"-)
  • Interpro: IPR030379  IPR027417  IPR016491  
  • Prosite: PS51719
  • CDD: cd01850
  • DIP: 36161
  • STRING: ENSP00000264893
• Other Databases: GeneCards:  SEPTIN11  Malacards:  SEPTIN11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061640	cytoskeleton-dependent cytokinesis	IBA	biological process
GO:0060271	cilium assembly	IBA	biological process
GO:0032153	cell division site	IBA	cellular component
GO:0015630	microtubule cytoskeleton	IBA	cellular component
GO:0005940	septin ring	IBA	cellular component
GO:0003924	GTPase activity	IBA	molecular function
GO:0060090	molecular adaptor activity	IBA	molecular function
GO:0034613	cellular protein localization	IBA	biological process
GO:0031105	septin complex	IBA	cellular component
GO:0031105	septin complex	ISS	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098794	postsynapse	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0050807	regulation of synapse organization	IEA	biological process
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:0099629	postsynaptic specialization of symmetric synapse	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0031105	septin complex	IDA	cellular component
GO:0001725	stress fiber	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061640	cytoskeleton-dependent cytokinesis	IBA	biological process
GO:0060271	cilium assembly	IBA	biological process
GO:0032153	cell division site	IBA	cellular component
GO:0015630	microtubule cytoskeleton	IBA	cellular component
GO:0005940	septin ring	IBA	cellular component
GO:0003924	GTPase activity	IBA	molecular function
GO:0060090	molecular adaptor activity	IBA	molecular function
GO:0034613	cellular protein localization	IBA	biological process
GO:0031105	septin complex	IBA	cellular component
GO:0031105	septin complex	ISS	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098794	postsynapse	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0050807	regulation of synapse organization	IEA	biological process
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:0099629	postsynaptic specialization of symmetric synapse	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0031105	septin complex	IDA	cellular component
GO:0001725	stress fiber	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis
hsa05100	Bacterial invasion of epithelial cells

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R