• Gene id: 55751

Gene Summary

• Gene Symbol: TMEM184C   Gene   UCSC   Ensembl
• Aliases: TMEM34
• Gene name: transmembrane protein 184C
• Alternate names: transmembrane protein 184C, transmembrane protein 34,
• Gene location: 4q31.23 (147617370: 147637272)     Exons: 10     NC_000004.12
• OMIM: 616156

Protein Summary

• Protein general information: Q9NVA4  
  • Name: Transmembrane protein 184C (Transmembrane protein 34)
  • Length: 438  
  • Mass: 50142
  • Tissue specificity: Widely expressed with higher expression in lung, kidney, spleen, pancreas, thymus, prostate, testis, ovary, small intestine and thyroid. {ECO
• Sequence:

  MPCTCTWRNWRQWIRPLVAVIYLVSIVVAVPLCVWELQKLEVGIHTKAWFIAGIFLLLTIPISLWVILQHLVHYT
  QPELQKPIIRILWMVPIYSLDSWIALKYPGIAIYVDTCRECYEAYVIYNFMGFLTNYLTNRYPNLVLILEAKDQQ
  KHFPPLCCCPPWAMGEVLLFRCKLGVLQYTVVRPFTTIVALICELLGIYDEGNFSFSNAWTYLVIINNMSQLFAM
  YCLLLFYKVLKEELSPIQPVGKFLCVKLVVFVSFWQAVVIALLVKVGVISEKHTWEWQTVEAVATGLQDFIICIE
  MFLAAIAHHYTFSYKPYVQEAEEGSCFDSFLAMWDVSDIRDDISEQVRHVGRTVRGHPRKKLFPEDQDQNEHTSL
  LSSSSQDAISIASSMPPSPMGHYQGFGHTVTPQTTPTTAKISDEILSDTIGEKKEPSDKSVDS

• Structural information:
  • Interpro: IPR005178  
  • STRING: ENSP00000296582
• Other Databases: GeneCards:  TMEM184C  Malacards:  TMEM184C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IBA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881