• Gene id: 5575

Gene Summary

• Gene Symbol: PRKAR1B   Gene   UCSC   Ensembl
• Aliases: PRKAR1
• Gene name: protein kinase cAMP-dependent type I regulatory subunit beta
• Alternate names: cAMP-dependent protein kinase type I-beta regulatory subunit, protein kinase, cAMP-dependent, regulatory subunit type I beta, protein kinase, cAMP-dependent, regulatory, type I, beta,
• Gene location: 7p22.3 (727675: 549184)     Exons: 17     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene is a regulatory subunit of cyclic AMP-dependent protein kinase A (PKA), which is involved in the signaling pathway of the second messenger cAMP. Two regulatory and two catalytic subunits form the PKA holoenzyme, disbands a
• OMIM: 609964

Protein Summary

• Protein general information: P31321  
  • Name: cAMP dependent protein kinase type I beta regulatory subunit
  • Length: 381  
  • Mass: 43073
  • Tissue specificity: Four types of regulatory chains are found
• Sequence:

  MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQKSNSQS
  DSHDEEVSPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIF
  DAMFPVTHIAGETVIQQGNEGDNFYVVDQGEVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWG
  IDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTA
  SVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNS
  FISLTV

• Structural information:
  • Interpro: IPR012198  IPR003117  IPR018490  IPR018488  IPR000595   IPR042818  IPR014710  
  • Prosite: PS00888 PS00889 PS50042
  • CDD: cd00038 cd12102
  • PDB: 4DIN 4F9K
  • PDBsum: 4DIN 4F9K
  • STRING: ENSP00000385749
• Other Databases: GeneCards:  PRKAR1B  Malacards:  PRKAR1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0005952	cAMP-dependent protein kinase complex	IBA	cellular component
GO:0008603	cAMP-dependent protein kinase regulator activity	IBA	molecular function
GO:0010738	regulation of protein kinase A signaling	IBA	biological process
GO:0043949	regulation of cAMP-mediated signaling	IBA	biological process
GO:0005952	cAMP-dependent protein kinase complex	IEA	cellular component
GO:0001932	regulation of protein phosphorylation	IEA	biological process
GO:0008603	cAMP-dependent protein kinase regulator activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0030552	cAMP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0003091	renal water homeostasis	TAS	biological process
GO:0071377	cellular response to glucagon stimulus	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0034199	activation of protein kinase A activity	TAS	biological process
GO:0097546	ciliary base	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098693	regulation of synaptic vesicle cycle	IEA	biological process
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0007611	learning or memory	IEA	biological process
GO:0005952	cAMP-dependent protein kinase complex	IEA	cellular component
GO:0005771	multivesicular body	IEA	cellular component
GO:0098686	hippocampal mossy fiber to CA3 synapse	IEA	cellular component
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004862	cAMP-dependent protein kinase inhibitor activity	IDA	molecular function
GO:0008603	cAMP-dependent protein kinase regulator activity	IDA	molecular function
GO:0034236	protein kinase A catalytic subunit binding	IPI	molecular function
GO:0034236	protein kinase A catalytic subunit binding	IPI	molecular function
GO:2000480	negative regulation of cAMP-dependent protein kinase activity	IDA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005952	cAMP-dependent protein kinase complex	NAS	cellular component
GO:0006468	protein phosphorylation	NAS	biological process
GO:0008603	cAMP-dependent protein kinase regulator activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04910	Insulin signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 29961538
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray