• Gene id: 55748

Gene Summary

• Gene Symbol: CNDP2   Gene   UCSC   Ensembl
• Aliases: CN2, CPGL, HEL-S-13, HsT2298, PEPA
• Gene name: carnosine dipeptidase 2
• Alternate names: cytosolic non-specific dipeptidase, CNDP dipeptidase 2 (metallopeptidase M20 family), carnosinase-2, carnosine dipeptidase II, cytosolic nonspecific dipeptidase, epididymis secretory protein Li 13, glutamate carboxypeptidase-like protein 1, peptidase A,
• Gene location: 18q22.3 (74496362: 74523453)     Exons: 15     NC_000018.10
• Gene summary(Entrez): CNDP2, also known as tissue carnosinase and peptidase A (EC 3.4.13.18), is a nonspecific dipeptidase rather than a selective carnosinase (Teufel et al., 2003 [PubMed 12473676]).[supplied by OMIM, Mar 2008]
• OMIM: 169800

Protein Summary

• Protein general information: Q96KP4  
  • Name: Cytosolic non specific dipeptidase (EC 3.4.13.18) (CNDP dipeptidase 2) (Carnosine dipeptidase II) (Epididymis secretory protein Li 13) (Glutamate carboxypeptidase like protein 1) (Peptidase A)
  • Length: 475  
  • Mass: 52878
  • Tissue specificity: Isoform 1 is ubiquitously expressed with higher levels in kidney and liver (at protein level). Expressed in peripheral blood leukocytes (PubMed
• Sequence:

  MAALTTLFKYIDENQDRYIKKLAKWVAIQSVSAWPEKRGEIRRMMEVAAADVKQLGGSVELVDIGKQKLPDGSEI
  PLPPILLGRLGSDPQKKTVCIYGHLDVQPAALEDGWDSEPFTLVERDGKLYGRGSTDDKGPVAGWINALEAYQKT
  GQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVCISDNYWLGKKKPCITYGLRGICYFFIEVECSNK
  DLHSGVYGGSVHEAMTDLILLMGSLVDKRGNILIPGINEAVAAVTEEEHKLYDDIDFDIEEFAKDVGAQILLHSH
  KKDILMHRWRYPSLSLHGIEGAFSGSGAKTVIPRKVVGKFSIRLVPNMTPEVVGEQVTSYLTKKFAELRSPNEFK
  VYMGHGGKPWVSDFSHPHYLAGRRAMKTVFGVEPDLTREGGSIPVTLTFQEATGKNVMLLPVGSADDGAHSQNEK
  LNRYNYIEGTKMLAAYLYEVSQLKD

• Structural information:
  • Interpro: IPR001261  IPR017153  IPR002933  IPR011650  
  • Prosite: PS00759
  • PDB: 4RUH
  • PDBsum: 4RUH
  • STRING: ENSP00000325548
• Other Databases: GeneCards:  CNDP2  Malacards:  CNDP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0006508	proteolysis	IBA	biological process
GO:0008233	peptidase activity	IBA	molecular function
GO:0016805	dipeptidase activity	IBA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0016805	dipeptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0103046	alanylglutamate dipeptidase activity	IEA	molecular function
GO:0102008	cytosolic dipeptidase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006750	glutathione biosynthetic process	TAS	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016805	dipeptidase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00330	Arginine and proline metabolism
hsa00410	beta-Alanine metabolism
hsa00340	Histidine metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray