About Us

Search Result


Gene id 55744
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol COA1   Gene   UCSC   Ensembl
Aliases C7orf44, MITRAC15
Gene name cytochrome c oxidase assembly factor 1 homolog
Alternate names cytochrome c oxidase assembly factor 1 homolog, cytochrome c oxidase assembly protein 1 homolog, mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 15 kDa,
Gene location 7p13 (43729540: 43608451)     Exons: 17     NC_000007.14
OMIM 614769

Protein Summary

Protein general information Q9GZY4  

Name: Cytochrome c oxidase assembly factor 1 homolog (Mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 15 kDa)

Length: 146  Mass: 16694

Sequence MMWQKYAGSRRSMPLGARILFHGVFYAGGFAIVYYLIQKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKL
IDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE
Structural information
Interpro:  IPR014807  
STRING:   ENSP00000379218
Other Databases GeneCards:  COA1  Malacards:  COA1

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0031305 integral component of mit
ochondrial inner membrane
IBA cellular component
GO:0032981 mitochondrial respiratory
chain complex I assembly
IBA biological process
GO:0033617 mitochondrial cytochrome
c oxidase assembly
IBA biological process
GO:0031305 integral component of mit
ochondrial inner membrane
IDA cellular component
GO:0033617 mitochondrial cytochrome
c oxidase assembly
IMP biological process
GO:0032981 mitochondrial respiratory
chain complex I assembly
IMP biological process
GO:0005739 mitochondrion
IEA cellular component
GO:0016020 membrane
IEA cellular component
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0005743 mitochondrial inner membr
ane
IEA cellular component
GO:0005743 mitochondrial inner membr
ane
IEA cellular component
GO:0005739 mitochondrion
IDA cellular component
GO:0005829 cytosol
IDA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04714Thermogenesis
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract