• Gene id: 55742

Gene Summary

• Gene Symbol: PARVA   Gene   UCSC   Ensembl
• Aliases: CH-ILKBP, MXRA2
• Gene name: parvin alpha
• Alternate names: alpha-parvin, actopaxin, calponin-like integrin-linked kinase-binding protein, matrix-remodeling-associated protein 2,
• Gene location: 11p15.3 (12376440: 12535355)     Exons: 14     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling c
• OMIM: 608120

Protein Summary

• Protein general information: Q9NVD7  
  • Name: Alpha parvin (Actopaxin) (CH ILKBP) (Calponin like integrin linked kinase binding protein) (Matrix remodeling associated protein 2)
  • Length: 372  
  • Mass: 42244
  • Tissue specificity: Widely expressed, with highest levels in heart, skeletal muscle, kidney and liver. {ECO
• Sequence:

  MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLPLSPIPFELDPEDTML
  EENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSE
  IAQKQKLQTVLEKINETLKLPPRSIKWNVDSVHAKSLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGIL
  QSRQIQEEITGNTEALSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLM
  GLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE

• Structural information:
  • Protein Domains: (95..20-)
    1 (/note="Calponin-homology-(CH))
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00044-)
    (262..36-)
    2 (/note="Calponin-homology-(CH))
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00044"-)
  • Interpro: IPR001715  IPR036872  IPR028433  
  • Prosite: PS50021
  • PDB: 2K2R 2VZC 2VZD 2VZG 2VZI 3KMU 3KMW 3REP 6MIB
  • PDBsum: 2K2R 2VZC 2VZD 2VZG 2VZI 3KMU 3KMW 3REP 6MIB
  • STRING: ENSP00000334008
• Other Databases: GeneCards:  PARVA  Malacards:  PARVA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060271	cilium assembly	IBA	biological process
GO:0030031	cell projection assembly	IBA	biological process
GO:0015629	actin cytoskeleton	IBA	cellular component
GO:0003779	actin binding	IBA	molecular function
GO:0034446	substrate adhesion-dependent cell spreading	IBA	biological process
GO:0031532	actin cytoskeleton reorganization	IBA	biological process
GO:0007163	establishment or maintenance of cell polarity	IBA	biological process
GO:0005925	focal adhesion	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0071670	smooth muscle cell chemotaxis	ISS	biological process
GO:0070252	actin-mediated cell contraction	ISS	biological process
GO:0060271	cilium assembly	IMP	biological process
GO:0034113	heterotypic cell-cell adhesion	ISS	biological process
GO:0003148	outflow tract septum morphogenesis	ISS	biological process
GO:0002040	sprouting angiogenesis	ISS	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IMP	biological process
GO:0007163	establishment or maintenance of cell polarity	ISS	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0031532	actin cytoskeleton reorganization	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0030030	cell projection organization	IEA	biological process
GO:0008360	regulation of cell shape	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034446	substrate adhesion-dependent cell spreading	IEA	biological process
GO:0030027	lamellipodium	IEA	cellular component
GO:0007163	establishment or maintenance of cell polarity	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0005925	focal adhesion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0071670	smooth muscle cell chemotaxis	IEA	biological process
GO:0070252	actin-mediated cell contraction	IEA	biological process
GO:0034113	heterotypic cell-cell adhesion	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0003148	outflow tract septum morphogenesis	IEA	biological process
GO:0002040	sprouting angiogenesis	IEA	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0030018	Z disc	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005925	focal adhesion	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04510	Focal adhesion

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)