• Gene id: 55735

Gene Summary

• Gene Symbol: DNAJC11   Gene   UCSC   Ensembl
• Aliases: dJ126A5.1
• Gene name: DnaJ heat shock protein family (Hsp40) member C11
• Alternate names: dnaJ homolog subfamily C member 11, DnaJ (Hsp40) homolog, subfamily C, member 11, novel DnaJ domain-containing protein,
• Gene location: 1p36.31 (9091376: 9121634)     Exons: 5     NC_000016.10
• OMIM: 614827

Protein Summary

• Protein general information: Q9NVH1  
  • Name: DnaJ homolog subfamily C member 11
  • Length: 559  
  • Mass: 63278
• Sequence:

  MATALSEEELDNEDYYSLLNVRREASSEELKAAYRRLCMLYHPDKHRDPELKSQAERLFNLVHQAYEVLSDPQTR
  AIYDIYGKRGLEMEGWEVVERRRTPAEIREEFERLQREREERRLQQRTNPKGTISVGVDATDLFDRYDEEYEDVS
  GSSFPQIEINKMHISQSIEAPLTATDTAILSGSLSTQNGNGGGSINFALRRVTSAKGWGELEFGAGDLQGPLFGL
  KLFRNLTPRCFVTTNCALQFSSRGIRPGLTTVLARNLDKNTVGYLQWRWGIQSAMNTSIVRDTKTSHFTVALQLG
  IPHSFALISYQHKFQDDDQTRVKGSLKAGFFGTVVEYGAERKISRHSVLGAAVSVGVPQGVSLKVKLNRASQTYF
  FPIHLTDQLLPSAMFYATVGPLVVYFAMHRLIIKPYLRAQKEKELEKQRESAATDVLQKKQEAESAVRLMQESVR
  RIIEAEESRMGLIIVNAWYGKFVNDKSRKSEKVKVIDVTVPLQCLVKDSKLILTEASKAGLPGFYDPCVGEEKNL
  KVLYQFRGVLHQVMVLDSEALRIPKQSHRIDTDG

• Structural information:
  • Protein Domains: (14..8-)
    (/note="J-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00286"-)
  • Interpro: IPR024586  IPR001623  IPR018253  IPR036869  
  • Prosite: PS00636 PS50076
  • CDD: cd06257
  • STRING: ENSP00000366800
• Other Databases: GeneCards:  DNAJC11  Malacards:  DNAJC11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061617	MICOS complex	IBA	colocalizes with
GO:0005739	mitochondrion	IBA	cellular component
GO:0042407	cristae formation	IBA	biological process
GO:0061617	MICOS complex	IDA	colocalizes with
GO:0001401	SAM complex	IDA	colocalizes with
GO:0005739	mitochondrion	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042407	cristae formation	IEA	biological process
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0007007	inner mitochondrial membrane organization	IC	biological process
GO:0001401	SAM complex	HDA	cellular component
GO:0140275	MIB complex	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq