• Gene id: 55729

Gene Summary

• Gene Symbol: ATF7IP   Gene   UCSC   Ensembl
• Aliases: AM, ATF-IP, MCAF, MCAF1, p621
• Gene name: activating transcription factor 7 interacting protein
• Alternate names: activating transcription factor 7-interacting protein 1, ATF-interacting protein, ATF7-interacting protein, ATFa-associated modulator, MBD1-containing chromatin-associated factor 1,
• Gene location: 12p13.1 (14365631: 14502934)     Exons: 22     NC_000012.12
• Gene summary(Entrez): ATF7IP is a multifunctional nuclear protein that associates with heterochromatin. It can act as a transcriptional coactivator or corepressor depending upon its binding partners (summary by Liu et al., 2009 [PubMed 19106100]).[supplied by OMIM, Nov 2010]
• OMIM: 613644

Protein Summary

• Protein general information: Q6VMQ6  
  • Name: Activating transcription factor 7 interacting protein 1 (ATF interacting protein) (ATF IP) (ATF7 interacting protein) (ATFa associated modulator) (hAM) (MBD1 containing chromatin associated factor 1) (P621)
  • Length: 1270  
  • Mass: 136394
  • Tissue specificity: Detected at low levels in breast, lung and stomach; highly up-regulated in the corresponding cancerous tissues (at protein level). {ECO
• Sequence:

  MDSLEEPQKKVFKARKTMRVSDRQQLEAVYKVKEELLKTDVKLLNGNHENGDLDPTSPLENMDYIKDKEEVNGIE
  EICFDPEGSKAEWKETPCILSVNVKNKQDDDLNCEPLSPHNITPEPVSKLPAEPVSGDPAPGDLDAGDPASGVLA
  SGDSTSGDPTSSEPSSSDAASGDATSGDAPSGDVSPGDATSGDATADDLSSGDPTSSDPIPGEPVPVEPISGDCA
  ADDIASSEITSVDLASGAPASTDPASDDLASGDLSSSELASDDLATGELASDELTSESTFDRTFEPKSVPVCEPV
  PEIDNIEPSSNKDDDFLEKNGADEKLEQIQSKDSLDEKNKADNNIDANEETLETDDTTICSDRPPENEKKVEEDI
  ITELALGEDAISSSMEIDQGEKNEDETSADLVETINENVIEDNKSENILENTDSMETDEIIPILEKLAPSEDELT
  CFSKTSLLPIDETNPDLEEKMESSFGSPSKQESSESLPKEAFLVLSDEEDISGEKDESEVISQNETCSPAEVESN
  EKDNKPEEEEQVIHEDDERPSEKNEFSRRKRSKSEDMDNVQSKRRRYMEEEYEAEFQVKITAKGDINQKLQKVIQ
  WLLEEKLCALQCAVFDKTLAELKTRVEKIECNKRHKTVLTELQAKIARLTKRFEAAKEDLKKRHEHPPNPPVSPG
  KTVNDVNSNNNMSYRNAGTVRQMLESKRNVSESAPPSFQTPVNTVSSTNLVTPPAVVSSQPKLQTPVTSGSLTAT
  SVLPAPNTATVVATTQVPSGNPQPTISLQPLPVILHVPVAVSSQPQLLQSHPGTLVTNQPSGNVEFISVQSPPTV
  SGLTKNPVSLPSLPNPTKPNNVPSVPSPSIQRNPTASAAPLGTTLAVQAVPTAHSIVQATRTSLPTVGPSGLYSP
  STNRGPIQMKIPISAFSTSSAAEQNSNTTPRIENQTNKTIDASVSKKAADSTSQCGKATGSDSSGVIDLTMDDEE
  SGASQDPKKLNHTPVSTMSSSQPVSRPLQPIQPAPPLQPSGVPTSGPSQTTIHLLPTAPTTVNVTHRPVTQVTTR
  LPVPRAPANHQVVYTTLPAPPAQAPLRGTVMQAPAVRQVNPQNSVTVRVPQTTTYVVNNGLTLGSTGPQLTVHHR
  PPQVHTEPPRPVHPAPLPEAPQPQRLPPEAASTSLPQKPHLKLARVQSQNGIVLSWSVLEVDRSCATVDSYHLYA
  YHEEPSATVPSQWKKIGEVKALPLPMACTLTQFVSGSKYYFAVRAKDIYGRFGPFCDPQSTDVISSTQSS

• Structural information:
  • Protein Domains: (1160..127-)
    (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"-)
  • Interpro: IPR026085  IPR031870  IPR003961  IPR036116  IPR013783  
  • Prosite: PS50853
  • PDB: 2RPQ
  • PDBsum: 2RPQ
  • STRING: ENSP00000440440
• Other Databases: GeneCards:  ATF7IP  Malacards:  ATF7IP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050821	protein stabilization	IMP	biological process
GO:0031647	regulation of protein stability	IMP	biological process
GO:0005634	nucleus	IMP	cellular component
GO:0090309	positive regulation of DNA methylation-dependent heterochromatin assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0016887	ATPase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0006306	DNA methylation	IDA	biological process
GO:0045898	regulation of RNA polymerase II transcription preinitiation complex assembly	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)