• Gene id: 55723

Gene Summary

• Gene Symbol: ASF1B   Gene   UCSC   Ensembl
• Aliases: CIA-II
• Gene name: anti-silencing function 1B histone chaperone
• Alternate names: histone chaperone ASF1B, ASF1 anti-silencing function 1 homolog B, CCG1-interacting factor A-II, anti-silencing function protein 1 homolog B, hAsf1, hAsf1b, hCIA-II,
• Gene location: 19p13.12 (14136588: 14119511)     Exons: 4     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may pla
• OMIM: 125597

Protein Summary

• Protein general information: Q9NVP2  
  • Name: Histone chaperone ASF1B (Anti silencing function protein 1 homolog B) (hAsf1) (hAsf1b) (CCG1 interacting factor A II) (CIA II) (hCIA II)
  • Length: 202  
  • Mass: 22434
  • Tissue specificity: Highly expressed in testis and at lower levels in colon, small intestine and thymus. {ECO
• Sequence:

  MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQ
  ADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH
  INWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI

• Structural information:
  • Interpro: IPR006818  IPR036747  
  • PDB: 5BNX 5BO0
  • PDBsum: 5BNX 5BO0
  • DIP: 29242
  • STRING: ENSP00000263382
• Other Databases: GeneCards:  ASF1B  Malacards:  ASF1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042393	histone binding	IBA	molecular function
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0006335	DNA replication-dependent nucleosome assembly	IBA	biological process
GO:0006336	DNA replication-independent nucleosome assembly	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006333	chromatin assembly or disassembly	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007283	spermatogenesis	IEA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042393	histone binding	IEA	molecular function
GO:0006334	nucleosome assembly	IEA	biological process
GO:0001835	blastocyst hatching	IEA	biological process
GO:0000785	chromatin	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0006336	DNA replication-independent nucleosome assembly	IDA	biological process
GO:0006335	DNA replication-dependent nucleosome assembly	IDA	biological process
GO:0000790	nuclear chromatin	IDA	cellular component

Diseases

Associated diseases	References
Breast cancer	PMID:21179005
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray