• Gene id: 55718

Gene Summary

• Gene Symbol: POLR3E   Gene   UCSC   Ensembl
• Aliases: C37, RPC5, SIN
• Gene name: RNA polymerase III subunit E
• Alternate names: DNA-directed RNA polymerase III subunit RPC5, DNA-directed RNA polymerase III 80 kDa polypeptide, RNA polymerase III 80 kDa subunit RPC5, RNA polymerase III subunit C5, polymerase (RNA) III (DNA directed) polypeptide E (80kD), polymerase (RNA) III subunit E,
• Gene location: 16p12.2 (22297374: 22335102)     Exons: 21     NC_000016.10

Protein Summary

• Protein general information: Q9NVU0  
  • Name: DNA directed RNA polymerase III subunit RPC5 (RNA polymerase III subunit C5) (DNA directed RNA polymerase III 80 kDa polypeptide)
  • Length: 708  
  • Mass: 79898
• Sequence:

  MANEEDDPVVQEIDVYLAKSLAEKLYLFQYPVRPASMTYDDIPHLSAKIKPKQQKVELEMAIDTLNPNYCRSKGE
  QIALNVDGACADETSTYSSKLMDKQTFCSSQTTSNTSRYAAALYRQGELHLTPLHGILQLRPSFSYLDKADAKHR
  EREAANEAGDSSQDEAEDDVKQITVRFSRPESEQARQRRVQSYEFLQKKHAEEPWVHLHYYGLRDSRSEHERQYL
  LCPGSSGVENTELVKSPSEYLMMLMPPSQEEEKDKPVAPSNVLSMAQLRTLPLADQIKILMKNVKVMPFANLMSL
  LGPSIDSVAVLRGIQKVAMLVQGNWVVKSDILYPKDSSSPHSGVPAEVLCRGRDFVMWKFTQSRWVVRKEVATVT
  KLCAEDVKDFLEHMAVVRINKGWEFILPYDGEFIKKHPDVVQRQHMLWTGIQAKLEKVYNLVKETMPKKPDAQSG
  PAGLVCGDQRIQVAKTKAQQNHALLERELQRRKEQLRVPAVPPGVRIKEEPVSEEGEEDEEQEAEEEPMDTSPSG
  LHSKLANGLPLGRAAGTDSFNGHPPQGCASTPVARELKAFVEATFQRQFVLTLSELKRLFNLHLASLPPGHTLFS
  GISDRMLQDTVLAAGCKQILVPFPPQTAASPDEQKVFALWESGDMSDQHRQVLLEIFSKNYRVRRNMIQSRLTQE
  CGEDLSKQEVDKVLKDCCVSYGGMWYLKGTVQS

• Structural information:
  • Interpro: IPR006886  
  • STRING: ENSP00000299853
• Other Databases: GeneCards:  POLR3E  Malacards:  POLR3E

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005666	RNA polymerase III complex	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0003899	DNA-directed 5'-3' RNA polymerase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005666	RNA polymerase III complex	IDA	cellular component
GO:0032481	positive regulation of type I interferon production	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04623	Cytosolic DNA-sensing pathway
hsa03020	RNA polymerase

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881