• Gene id: 55716

Gene Summary

• Gene Symbol: LMBR1L   Gene   UCSC   Ensembl
• Aliases: LIMR
• Gene name: limb development membrane protein 1 like
• Alternate names: protein LMBR1L, limb region 1 homolog-like, limb region 1 protein homolog-like, limb region 1-like protein -like, lipocalin-1 interacting membrane receptor, lipocalin-interacting membrane receptor,
• Gene location: 12q13.12 (49110899: 49096550)     Exons: 19     NC_000012.12
• OMIM: 190196

Protein Summary

• Protein general information: Q6UX01  
  • Name: Protein LMBR1L (Limb region 1 protein homolog like) (Lipocalin 1 interacting membrane receptor) (LIMR)
  • Length: 489  
  • Mass: 55209
  • Tissue specificity: Expressed in testis, pituitary gland, adrenal gland, trachea, placenta, thymus, cerebellum, stomach, mammary gland, spinal cord. A weaker expression is detected in colon, pancreas, and prostate. {ECO
• Sequence:

  MEAPDYEVLSVREQLFHERIRECIISTLLFATLYILCHIFLTRFKKPAEFTTVDDEDATVNKIALELCTFTLAIA
  LGAVLLLPFSIISNEVLLSLPRNYYIQWLNGSLIHGLWNLVFLFSNLSLIFLMPFAYFFTESEGFAGSRKGVLGR
  VYETVVMLMLLTLLVLGMVWVASAIVDKNKANRESLYDFWEYYLPYLYSCISFLGVLLLLVCTPLGLARMFSVTG
  KLLVKPRLLEDLEEQLYCSAFEEAALTRRICNPTSCWLPLDMELLHRQVLALQTQRVLLEKRRKASAWQRNLGYP
  LAMLCLLVLTGLSVLIVAIHILELLIDEAAMPRGMQGTSLGQVSFSKLGSFGAVIQVVLIFYLMVSSVVGFYSSP
  LFRSLRPRWHDTAMTQIIGNCVCLLVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAGLTTLC
  LVKTFTAAVRAELIRAFGLDRLPLPVSGFPQASRKTQHQ

• Structural information:
  • Interpro: IPR008075  IPR006876  
  • STRING: ENSP00000267102
• Other Databases: GeneCards:  LMBR1L  Malacards:  LMBR1L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IBA	biological process
GO:0004888	transmembrane signaling receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006898	receptor-mediated endocytosis	IBA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0042098	T cell proliferation	ISS	biological process
GO:0060218	hematopoietic stem cell differentiation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070231	T cell apoptotic process	ISS	biological process
GO:0030217	T cell differentiation	ISS	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0006897	endocytosis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0042098	T cell proliferation	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0070231	T cell apoptotic process	IEA	biological process
GO:0060218	hematopoietic stem cell differentiation	IEA	biological process
GO:0030217	T cell differentiation	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007165	signal transduction	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0004888	transmembrane signaling receptor activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006898	receptor-mediated endocytosis	IMP	biological process
GO:0007165	signal transduction	IBA	biological process
GO:0004888	transmembrane signaling receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006898	receptor-mediated endocytosis	IBA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0042098	T cell proliferation	ISS	biological process
GO:0060218	hematopoietic stem cell differentiation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070231	T cell apoptotic process	ISS	biological process
GO:0030217	T cell differentiation	ISS	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0006897	endocytosis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0042098	T cell proliferation	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0070231	T cell apoptotic process	IEA	biological process
GO:0060218	hematopoietic stem cell differentiation	IEA	biological process
GO:0030217	T cell differentiation	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007165	signal transduction	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0004888	transmembrane signaling receptor activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006898	receptor-mediated endocytosis	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881