• Gene id: 5570

Gene Summary

• Gene Symbol: PKIB   Gene   UCSC   Ensembl
• Aliases: PRKACN2
• Gene name: cAMP-dependent protein kinase inhibitor beta
• Alternate names: cAMP-dependent protein kinase inhibitor beta, PKI-beta, cAMP-dependent protein kinase inhibitor 2, protein kinase (cAMP-dependent, catalytic) inhibitor beta,
• Gene location: 6q22.31 (122471916: 122726372)     Exons: 16     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the cAMP-dependent protein kinase inhibitor family. The encoded protein may play a role in the protein kinase A (PKA) pathway by interacting with the catalytic subunit of PKA, and overexpression of this gene may play a role i
• OMIM: 606914

Protein Summary

• Protein general information: Q9C010  
  • Name: cAMP dependent protein kinase inhibitor beta (PKI beta)
  • Length: 78  
  • Mass: 8468
• Sequence:

  MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQN
  EEK

• Structural information:
  • Interpro: IPR004171  
  • STRING: ENSP00000480824
• Other Databases: GeneCards:  PKIB  Malacards:  PKIB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004862	cAMP-dependent protein kinase inhibitor activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:2000480	negative regulation of cAMP-dependent protein kinase activity	IBA	biological process
GO:0004862	cAMP-dependent protein kinase inhibitor activity	IEA	molecular function
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0004860	protein kinase inhibitor activity	IEA	molecular function
GO:0032212	positive regulation of telomere maintenance via telomerase	IMP	biological process
GO:1904355	positive regulation of telomere capping	IMP	biological process
GO:0051973	positive regulation of telomerase activity	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray