• Gene id: 5569

Gene Summary

• Gene Symbol: PKIA   Gene   UCSC   Ensembl
• Aliases: PRKACN1
• Gene name: cAMP-dependent protein kinase inhibitor alpha
• Alternate names: cAMP-dependent protein kinase inhibitor alpha, PKI-alpha, cAMP-dependent protein kinase inhibitor, muscle/brain isoform, protein kinase (cAMP-dependent, catalytic) inhibitor alpha,
• Gene location: 8q21.13 (78516339: 78605266)     Exons: 7     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the cAMP-dependent protein kinase (PKA) inhibitor family. This protein was demonstrated to interact with and inhibit the activities of both C alpha and C beta catalytic subunits of the PKA. Alternatively spl
• OMIM: 606059

Protein Summary

• Protein general information: P61925  
  • Name: cAMP dependent protein kinase inhibitor alpha (PKI alpha) (cAMP dependent protein kinase inhibitor, muscle/brain isoform)
  • Length: 76  
  • Mass: 7989
• Sequence:

  MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGEAAKSE
  S

• Structural information:
  • Interpro: IPR004171  
  • PDB: 1CMK 1JLU 1Q8T 1VEB 1XH4 1XH5 1XH6 1XH7 1XH8 1XH9 1XHA 1YDR 2C1A 2C1B 2F7E 2GNI 2JDS 2JDT 2JDV 2L1L 2UVX 2UVY 2UVZ 2UW0 2UW3 2UW4 2UW5 2UW6 2UW7 2UW8 2VNW 2VNY 2VO0 2VO3 2VO6 2VO7 3AMA 3AMB 3L9L 3L9M 3L9N 3MVJ 3NX8 3OOG 3OVV 3OWP 3OXT 3P0M 3POO 3VQH 3WYG 3X2U 3X2V 3X2W 4AXA 4IAC 4IAD 4IAF 4IAI 4IAK 4IAY 4IAZ 4IB0 4IB
  • PDBsum: 1CMK 1JLU 1Q8T 1VEB 1XH4 1XH5 1XH6 1XH7 1XH8 1XH9 1XHA 1YDR 2C1A 2C1B 2F7E 2GNI 2JDS 2JDT 2JDV 2L1L 2UVX 2UVY 2UVZ 2UW0 2UW3 2UW4 2UW5 2UW6 2UW7 2UW8 2VNW 2VNY 2VO0 2VO3 2VO6 2VO7 3AMA 3AMB 3L9L 3L9M 3L9N 3MVJ 3NX8 3OOG 3OVV 3OWP 3OXT 3P0M 3POO 3VQH 3WYG 3X2U 3X2V 3X2W 4AXA 4IAC 4IAD 4IAF 4IAI 4IAK 4IAY 4IAZ 4IB0 4IB
  • DIP: 56176
  • STRING: ENSP00000379696
• Other Databases: GeneCards:  PKIA  Malacards:  PKIA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004862	cAMP-dependent protein kinase inhibitor activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:2000480	negative regulation of cAMP-dependent protein kinase activity	IBA	biological process
GO:0004862	cAMP-dependent protein kinase inhibitor activity	IEA	molecular function
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0004860	protein kinase inhibitor activity	IEA	molecular function
GO:2000480	negative regulation of cAMP-dependent protein kinase activity	IDA	biological process
GO:0004862	cAMP-dependent protein kinase inhibitor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0042308	negative regulation of protein import into nucleus	IEA	biological process
GO:0034236	protein kinase A catalytic subunit binding	IEA	molecular function
GO:0010389	regulation of G2/M transition of mitotic cell cycle	IEA	biological process
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004862	cAMP-dependent protein kinase inhibitor activity	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0034236	protein kinase A catalytic subunit binding	IPI	molecular function
GO:0034236	protein kinase A catalytic subunit binding	IPI	molecular function
GO:0004862	cAMP-dependent protein kinase inhibitor activity	IDA	molecular function
GO:2000480	negative regulation of cAMP-dependent protein kinase activity	IDA	biological process
GO:0004862	cAMP-dependent protein kinase inhibitor activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05034	Alcoholism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881