• Gene id: 5568

Gene Summary

• Gene Symbol: PRKACG   Gene   UCSC   Ensembl
• Aliases: BDPLT19, KAPG, PKACg
• Gene name: protein kinase cAMP-activated catalytic subunit gamma
• Alternate names: cAMP-dependent protein kinase catalytic subunit gamma, PKA C-gamma, protein kinase, cAMP-dependent, catalytic, gamma, protein kinase, cAMP-dependent, gamma catalytic subunit, serine(threonine) protein kinase,
• Gene location: 9q21.11 (69014112: 69012503)     Exons: 1     NC_000009.12
• Gene summary(Entrez): Cyclic AMP-dependent protein kinase (PKA) consists of two catalytic subunits and a regulatory subunit dimer. This gene encodes the gamma form of its catalytic subunit. The gene is intronless and is thought to be a retrotransposon derived from the gene for
• OMIM: 176893

Protein Summary

• Protein general information: P22612  
  • Name: cAMP dependent protein kinase catalytic subunit gamma (PKA C gamma) (EC 2.7.11.11)
  • Length: 351  
  • Mass: 40434
  • Tissue specificity: Testis specific. But important tissues such as brain and ovary have not been analyzed for the content of transcript.
• Sequence:

  MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKIL
  NKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQ
  VVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWAL
  GVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFAT
  TSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF

• Structural information:
  • Protein Domains: (44..29-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (299..35-)
    (/note="AGC-kinase-C-terminal")
  • Interpro: IPR000961  IPR011009  IPR039084  IPR000719  IPR017441   IPR008271  
  • Prosite: PS51285 PS00107 PS50011 PS00108
  • STRING: ENSP00000366488
• Other Databases: GeneCards:  PRKACG  Malacards:  PRKACG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010737	protein kinase A signaling	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004691	cAMP-dependent protein kinase activity	TAS	molecular function
GO:0008584	male gonad development	TAS	biological process
GO:0007283	spermatogenesis	TAS	biological process
GO:0004679	AMP-activated protein kinase activity	IEA	molecular function
GO:0004691	cAMP-dependent protein kinase activity	IEA	molecular function
GO:0003091	renal water homeostasis	TAS	biological process
GO:0034380	high-density lipoprotein particle assembly	TAS	biological process
GO:0071377	cellular response to glucagon stimulus	TAS	biological process
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0034199	activation of protein kinase A activity	TAS	biological process
GO:0097546	ciliary base	TAS	cellular component
GO:0097546	ciliary base	TAS	cellular component
GO:0045171	intercellular bridge	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05165	Human papillomavirus infection
hsa04010	MAPK signaling pathway
hsa05012	Parkinson disease
hsa04714	Thermogenesis
hsa04014	Ras signaling pathway
hsa04024	cAMP signaling pathway
hsa05166	Human T-cell leukemia virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa04020	Calcium signaling pathway
hsa04062	Chemokine signaling pathway
hsa05034	Alcoholism
hsa05203	Viral carcinogenesis
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04530	Tight junction
hsa04723	Retrograde endocannabinoid signaling
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04934	Cushing syndrome
hsa04140	Autophagy - animal
hsa04740	Olfactory transduction
hsa04921	Oxytocin signaling pathway
hsa04371	Apelin signaling pathway
hsa04910	Insulin signaling pathway
hsa04728	Dopaminergic synapse
hsa04724	Glutamatergic synapse
hsa04270	Vascular smooth muscle contraction
hsa04114	Oocyte meiosis
hsa04611	Platelet activation
hsa04926	Relaxin signaling pathway
hsa04725	Cholinergic synapse
hsa04935	Growth hormone synthesis, secretion and action
hsa04919	Thyroid hormone signaling pathway
hsa04915	Estrogen signaling pathway
hsa04726	Serotonergic synapse
hsa04922	Glucagon signaling pathway
hsa04916	Melanogenesis
hsa05032	Morphine addiction
hsa04727	GABAergic synapse
hsa04713	Circadian entrainment
hsa04925	Aldosterone synthesis and secretion
hsa04928	Parathyroid hormone synthesis, secretion and action
hsa05414	Dilated cardiomyopathy
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04970	Salivary secretion
hsa04914	Progesterone-mediated oocyte maturation
hsa04912	GnRH signaling pathway
hsa04911	Insulin secretion
hsa04540	Gap junction
hsa04211	Longevity regulating pathway
hsa01522	Endocrine resistance
hsa05146	Amoebiasis
hsa04971	Gastric acid secretion
hsa04918	Thyroid hormone synthesis
hsa04742	Taste transduction
hsa04720	Long-term potentiation
hsa05031	Amphetamine addiction
hsa04924	Renin secretion
hsa04976	Bile secretion
hsa04961	Endocrine and other factor-regulated calcium reabsorption
hsa04927	Cortisol synthesis and secretion
hsa05110	Vibrio cholerae infection
hsa04213	Longevity regulating pathway - multiple species
hsa05030	Cocaine addiction
hsa04340	Hedgehog signaling pathway
hsa04923	Regulation of lipolysis in adipocytes
hsa04962	Vasopressin-regulated water reabsorption
hsa04913	Ovarian steroidogenesis
hsa05020	Prion diseases
P06959	CCKR signaling map

Diseases

Associated diseases	References
Macrothrombocytopenia	KEGG:H01740
Macrothrombocytopenia	KEGG:H01740
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)