• Gene id: 55676

Gene Summary

• Gene Symbol: SLC30A6   Gene   UCSC   Ensembl
• Aliases: MST103, MSTP103, ZNT6
• Gene name: solute carrier family 30 member 6
• Alternate names: zinc transporter 6, solute carrier family 30 (zinc transporter), member 6,
• Gene location: 2p22.3 (32165840: 32224378)     Exons: 19     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of a family of proteins that function as zinc transporters. This protein can regulate subcellular levels of zinc in the Golgi and vesicles. Expression of this gene is altered in the Alzheimer's disease brain plaques. [provided b

Protein Summary

• Protein general information: Q6NXT4  
  • Name: Zinc transporter 6 (ZnT 6) (Solute carrier family 30 member 6)
  • Length: 461  
  • Mass: 51116
  • Tissue specificity: Expressed in brain; especially in cerebellum, hippocampus, parahippocampal gyrus, superior and middle temporal gyrus. Also expressed in B-cells, colon, eye, and lung. Lower expression was present in bone, brain, cervix, ear, heart, kid
• Sequence:

  MGTIHLFRKPQRSFFGKLLREFRLVAADRRSWKILLFGVINLICTGFLLMWCSSTNSIALTAYTYLTIFDLFSLM
  TCLISYWVTLRKPSPVYSFGFERLEVLAVFASTVLAQLGALFILKESAERFLEQPEIHTGRLLVGTFVALCFNLF
  TMLSIRNKPFAYVSEAASTSWLQEHVADLSRSLCGIIPGLSSIFLPRMNPFVLIDLAGAFALCITYMLIEINNYF
  AVDTASAIAIALMTFGTMYPMSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVH
  VRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANVLNFSDHHVIPMPLLKGTDDLNPVTS
  TPAKPSSPPPEFSFNTPGKNVNPVILLNTQTRPYGFGLNHGHTPYSSMLNQGLGVPGIGATQGLRTGFTNIPSRY
  GTNNRIGQPRP

• Structural information:
  • Interpro: IPR002524  IPR027469  
  • STRING: ENSP00000368648
• Other Databases: GeneCards:  SLC30A6  Malacards:  SLC30A6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006812	cation transport	IEA	biological process
GO:0008324	cation transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0006829	zinc ion transport	IEA	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005385	zinc ion transmembrane transporter activity	TAS	molecular function
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0098655	cation transmembrane transport	IEA	biological process
GO:0071577	zinc ion transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881