• Gene id: 55670

Gene Summary

• Gene Symbol: PEX26   Gene   UCSC   Ensembl
• Aliases: PBD7A, PBD7B, PEX26M1T, Pex26pM1T
• Gene name: peroxisomal biogenesis factor 26
• Alternate names: peroxisome assembly protein 26, peroxin-26, peroxisome biogenesis disorder, complementation group 8, peroxisome biogenesis disorder, complementation group A, peroxisome biogenesis factor 26,
• Gene location: 22q11.21 (18077989: 18105395)     Exons: 5     NC_000022.11
• Gene summary(Entrez): This gene belongs to the peroxin-26 gene family. It is probably required for protein import into peroxisomes. It anchors PEX1 and PEX6 to peroxisome membranes, possibly to form heteromeric AAA ATPase complexes required for the import of proteins into pero
• OMIM: 608666

Protein Summary

• Protein general information: Q7Z412  
  • Name: Peroxisome assembly protein 26 (Peroxin 26)
  • Length: 305  
  • Mass: 33898
  • Tissue specificity: Widely expressed. Highly expressed in kidney, liver, brain and skeletal muscles. Expressed at intermediate level in pancreas, placenta and heart. Weakly expressed in lung. {ECO
• Sequence:

  MKSDSSTSAAPLRGLGGPLRSSEPVRAVPARAPAVDLLEEAADLLVVHLDFRAALETCERAWQSLANHAVAEEPA
  GTSLEVKCSLCVVGIQALAEMDRWQEVLSWVLQYYQVPEKLPPKVLELCILLYSKMQEPGAVLDVVGAWLQDPAN
  QNLPEYGALAEFHVQRVLLPLGCLSEAEELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSV
  SHKFLSLPMLVRQLWDSAVSHFFSLPFKKSLLAALILCLLVVRFDPASPSSLHFLYKLAQLFRWIRKAAFSRLYQ
  LRIRD

• Structural information:
  • Interpro: IPR010797  
  • STRING: ENSP00000331106
• Other Databases: GeneCards:  PEX26  Malacards:  PEX26

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051117	ATPase binding	IBA	molecular function
GO:0016558	protein import into peroxisome matrix	IBA	biological process
GO:0005777	peroxisome	IBA	cellular component
GO:0045046	protein import into peroxisome membrane	IEA	biological process
GO:0005779	integral component of peroxisomal membrane	IEA	cellular component
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005778	peroxisomal membrane	TAS	cellular component
GO:0005778	peroxisomal membrane	TAS	cellular component
GO:0005778	peroxisomal membrane	TAS	cellular component
GO:0006625	protein targeting to peroxisome	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0005777	peroxisome	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0016558	protein import into peroxisome matrix	IDA	biological process
GO:0016558	protein import into peroxisome matrix	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04146	Peroxisome

Diseases

Associated diseases	References
Peroxisome biogenesis disorder	KEGG:H00205
Zellweger syndrome	KEGG:H01342
Neonatal adrenoleukodystrophy	KEGG:H00177
Infantile Refsum disease	KEGG:H00204
Peroxisome biogenesis disorder	KEGG:H00205
Zellweger syndrome	KEGG:H01342
Neonatal adrenoleukodystrophy	KEGG:H00177
Infantile Refsum disease	KEGG:H00204
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq