Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 55662
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary
Gene Symbol HIF1AN   Gene   UCSC   Ensembl
Aliases FIH1
Gene name hypoxia inducible factor 1 subunit alpha inhibitor
Alternate names hypoxia-inducible factor 1-alpha inhibitor, FIH-1, factor inhibiting HIF-1, factor inhibiting HIF1, hypoxia inducible factor 1 alpha subunit inhibitor, hypoxia-inducible factor asparagine hydroxylase, peptide-aspartate beta-dioxygenase,
Gene location 10q24.31 (100535920: 100559997)     Exons: 8     NC_000010.11
OMIM 603764

Protein Summary
Protein general information Q9NWT6  

Name: Hypoxia inducible factor 1 alpha inhibitor (EC 1.14.11.30) (EC 1.14.11.n4) (Factor inhibiting HIF 1) (FIH 1) (Hypoxia inducible factor asparagine hydroxylase)

Length: 349  Mass: 40285

Sequence MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALK
WDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTL
NDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFE
CLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGA
PTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Structural information
Protein Domains
 (142..31-)
(/note="JmjC-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00538"-)
Interpro:  IPR041667  IPR027445  IPR027452  IPR003347  
Prosite:   PS51184

PDB:  		 1H2K 1H2L 1H2M 1H2N 1IZ3 1MZE 1MZF 1YCI 2CGN 2CGO 2ILM 2W0X 2WA3 2WA4 2XUM 2Y0I 2YC0 2YDE 3D8C 3KCX 3KCY 3OD4 3P3N 3P3P 4AI8 4B7E 4B7K 4BIO 4JAA 4NR1 4Z1V 4Z2W 5JWK 5JWL 5JWP 5OP6 5OP8 5OPC 6H9J 6HA6 6HC8 6HKP 6HL5 6HL6
PDBsum:   1H2K 1H2L 1H2M 1H2N 1IZ3 1MZE 1MZF 1YCI 2CGN 2CGO 2ILM 2W0X 2WA3 2WA4 2XUM 2Y0I 2YC0 2YDE 3D8C 3KCX 3KCY 3OD4 3P3N 3P3P 4AI8 4B7E 4B7K 4BIO 4JAA 4NR1 4Z1V 4Z2W 5JWK 5JWL 5JWP 5OP6 5OP8 5OPC 6H9J 6HA6 6HC8 6HKP 6HL5 6HL6

DIP:  
35527
MINT:  
STRING:   ENSP00000299163
Other Databases GeneCards:  HIF1AN  Malacards:  HIF1AN

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0016706 2-oxoglutarate-dependent
dioxygenase activity
 IBA molecular function
GO:0036139 peptidyl-histidine dioxyg
enase activity
 IBA molecular function
GO:0045746 negative regulation of No
tch signaling pathway
 IBA biological process
GO:0061428 negative regulation of tr
anscription from RNA poly
merase II promoter in res
ponse to hypoxia
 IBA biological process
GO:0071532 ankyrin repeat binding
 IBA molecular function
GO:0005737 cytoplasm
 IBA cellular component
GO:0036138 peptidyl-histidine hydrox
ylation
 IBA biological process
GO:0036140 peptidyl-asparagine 3-dio
xygenase activity
 IBA molecular function
GO:0042264 peptidyl-aspartic acid hy
droxylation
 IBA biological process
GO:0042265 peptidyl-asparagine hydro
xylation
 IBA biological process
GO:0055114 oxidation-reduction proce
ss
 IEA biological process
GO:0046872 metal ion binding
 IEA molecular function
GO:0005737 cytoplasm
 IEA cellular component
GO:0016491 oxidoreductase activity
 IEA molecular function
GO:0005634 nucleus
 IEA cellular component
GO:0051213 dioxygenase activity
 IEA molecular function
GO:0102113 hypoxia-inducible factor-
asparagine oxygenase acti
vity
 IEA molecular function
GO:0005829 cytosol
 TAS cellular component
GO:0061418 regulation of transcripti
on from RNA polymerase II
promoter in response to
hypoxia
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0048471 perinuclear region of cyt
oplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0005829 cytosol
 IDA cellular component
GO:0055114 oxidation-reduction proce
ss
 IDA biological process
GO:0042803 protein homodimerization
activity
 IDA molecular function
GO:0036139 peptidyl-histidine dioxyg
enase activity
 IDA molecular function
GO:0042265 peptidyl-asparagine hydro
xylation
 IDA biological process
GO:0042265 peptidyl-asparagine hydro
xylation
 IDA biological process
GO:0042264 peptidyl-aspartic acid hy
droxylation
 IDA biological process
GO:0036140 peptidyl-asparagine 3-dio
xygenase activity
 IDA molecular function
GO:0036138 peptidyl-histidine hydrox
ylation
 IDA biological process
GO:0005737 cytoplasm
 IDA cellular component
GO:0005634 nucleus
 IDA colocalizes with
GO:0008198 ferrous iron binding
 IDA molecular function
GO:0061428 negative regulation of tr
anscription from RNA poly
merase II promoter in res
ponse to hypoxia
 IDA biological process
GO:0055114 oxidation-reduction proce
ss
 IDA biological process
GO:0048471 perinuclear region of cyt
oplasm
 IDA cellular component
GO:0045746 negative regulation of No
tch signaling pathway
 IDA biological process
GO:0031406 carboxylic acid binding
 IDA molecular function
GO:0008270 zinc ion binding
 IDA molecular function
GO:0045663 positive regulation of my
oblast differentiation
 IDA biological process
GO:0042265 peptidyl-asparagine hydro
xylation
 IDA biological process
GO:0042265 peptidyl-asparagine hydro
xylation
 IDA biological process
GO:0036140 peptidyl-asparagine 3-dio
xygenase activity
 IDA molecular function
GO:2001214 positive regulation of va
sculogenesis
 NAS biological process
GO:0051059 NF-kappaB binding
 IPI molecular function
GO:0042265 peptidyl-asparagine hydro
xylation
 IMP biological process
GO:0036140 peptidyl-asparagine 3-dio
xygenase activity
 IMP molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0071532 ankyrin repeat binding
 IPI molecular function
GO:0071532 ankyrin repeat binding
 IPI molecular function
GO:0071532 ankyrin repeat binding
 IPI molecular function
GO:0071532 ankyrin repeat binding
 IPI molecular function
GO:0019826 oxygen sensor activity
 NAS molecular function
GO:0005112 Notch binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0071532 ankyrin repeat binding
 IPI molecular function
GO:0071532 ankyrin repeat binding
 IPI molecular function
GO:0071532 ankyrin repeat binding
 IPI molecular function
GO:0005112 Notch binding
 IPI molecular function
GO:0005112 Notch binding
 IPI molecular function
GO:0016706 2-oxoglutarate-dependent
dioxygenase activity
 IBA molecular function
GO:0036139 peptidyl-histidine dioxyg
enase activity
 IBA molecular function
GO:0045746 negative regulation of No
tch signaling pathway
 IBA biological process
GO:0061428 negative regulation of tr
anscription from RNA poly
merase II promoter in res
ponse to hypoxia
 IBA biological process
GO:0071532 ankyrin repeat binding
 IBA molecular function
GO:0005737 cytoplasm
 IBA cellular component
GO:0036138 peptidyl-histidine hydrox
ylation
 IBA biological process
GO:0036140 peptidyl-asparagine 3-dio
xygenase activity
 IBA molecular function
GO:0042264 peptidyl-aspartic acid hy
droxylation
 IBA biological process
GO:0042265 peptidyl-asparagine hydro
xylation
 IBA biological process
GO:0055114 oxidation-reduction proce
ss
 IEA biological process
GO:0046872 metal ion binding
 IEA molecular function
GO:0005737 cytoplasm
 IEA cellular component
GO:0016491 oxidoreductase activity
 IEA molecular function
GO:0005634 nucleus
 IEA cellular component
GO:0051213 dioxygenase activity
 IEA molecular function
GO:0102113 hypoxia-inducible factor-
asparagine oxygenase acti
vity
 IEA molecular function
GO:0005829 cytosol
 TAS cellular component
GO:0061418 regulation of transcripti
on from RNA polymerase II
promoter in response to
hypoxia
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0048471 perinuclear region of cyt
oplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0005829 cytosol
 IDA cellular component
GO:0055114 oxidation-reduction proce
ss
 IDA biological process
GO:0042803 protein homodimerization
activity
 IDA molecular function
GO:0036139 peptidyl-histidine dioxyg
enase activity
 IDA molecular function
GO:0042265 peptidyl-asparagine hydro
xylation
 IDA biological process
GO:0042265 peptidyl-asparagine hydro
xylation
 IDA biological process
GO:0042264 peptidyl-aspartic acid hy
droxylation
 IDA biological process
GO:0036140 peptidyl-asparagine 3-dio
xygenase activity
 IDA molecular function
GO:0036138 peptidyl-histidine hydrox
ylation
 IDA biological process
GO:0005737 cytoplasm
 IDA cellular component
GO:0005634 nucleus
 IDA colocalizes with
GO:0008198 ferrous iron binding
 IDA molecular function
GO:0061428 negative regulation of tr
anscription from RNA poly
merase II promoter in res
ponse to hypoxia
 IDA biological process
GO:0055114 oxidation-reduction proce
ss
 IDA biological process
GO:0048471 perinuclear region of cyt
oplasm
 IDA cellular component
GO:0045746 negative regulation of No
tch signaling pathway
 IDA biological process
GO:0031406 carboxylic acid binding
 IDA molecular function
GO:0008270 zinc ion binding
 IDA molecular function
GO:0045663 positive regulation of my
oblast differentiation
 IDA biological process
GO:0042265 peptidyl-asparagine hydro
xylation
 IDA biological process
GO:0042265 peptidyl-asparagine hydro
xylation
 IDA biological process
GO:0036140 peptidyl-asparagine 3-dio
xygenase activity
 IDA molecular function
GO:2001214 positive regulation of va
sculogenesis
 NAS biological process
GO:0051059 NF-kappaB binding
 IPI molecular function
GO:0042265 peptidyl-asparagine hydro
xylation
 IMP biological process
GO:0036140 peptidyl-asparagine 3-dio
xygenase activity
 IMP molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0071532 ankyrin repeat binding
 IPI molecular function
GO:0071532 ankyrin repeat binding
 IPI molecular function
GO:0071532 ankyrin repeat binding
 IPI molecular function
GO:0071532 ankyrin repeat binding
 IPI molecular function
GO:0019826 oxygen sensor activity
 NAS molecular function
GO:0005112 Notch binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0071532 ankyrin repeat binding
 IPI molecular function
GO:0071532 ankyrin repeat binding
 IPI molecular function
GO:0071532 ankyrin repeat binding
 IPI molecular function
GO:0005112 Notch binding
 IPI molecular function
GO:0005112 Notch binding
 IPI molecular function

Diseases

Expand All | Collapse All
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract