• Gene id: 55647

Gene Summary

• Gene Symbol: RAB20   Gene   UCSC   Ensembl
• Gene name: RAB20, member RAS oncogene family
• Alternate names: ras-related protein Rab-20,
• Gene location: 13q34 (110561721: 110523065)     Exons: 2     NC_000013.11

Protein Summary

• Protein general information: Q9NX57  
  • Name: Ras related protein Rab 20
  • Length: 234  
  • Mass: 26277
  • Tissue specificity: Low or absent expression in normal pancreas and stronger expression in 15 of 18 exocrine pancreatic adenocarcinomas (at protein level). {ECO
• Sequence:

  MRKPDSKIVLLGDMNVGKTSLLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGREQFHGLGSMYCRGAAA
  IILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDRVSPRAPKQVQ
  LEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPP
  KRTRSGCCA

• Structural information:
  • Interpro: IPR027417  IPR041836  IPR005225  IPR001806  
  • Prosite: PS51419
  • CDD: cd04126
  • STRING: ENSP00000267328
• Other Databases: GeneCards:  RAB20  Malacards:  RAB20

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0012505	endomembrane system	IBA	cellular component
GO:0005768	endosome	IBA	cellular component
GO:0003924	GTPase activity	IBA	molecular function
GO:0030139	endocytic vesicle	IBA	cellular component
GO:0030100	regulation of endocytosis	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0005769	early endosome	IBA	cellular component
GO:0045335	phagocytic vesicle	IDA	cellular component
GO:0090385	phagosome-lysosome fusion	IMP	biological process
GO:0090383	phagosome acidification	IMP	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0071346	cellular response to interferon-gamma	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq