• Gene id: 55646

Gene Summary

• Gene Symbol: LYAR   Gene   UCSC   Ensembl
• Aliases: ZC2HC2, ZLYAR
• Gene name: Ly1 antibody reactive
• Alternate names: cell growth-regulating nucleolar protein, Ly1 antibody reactive homolog,
• Gene location: 4p16.3 (171687468: 171750157)     Exons: 19     NC_000002.12
• OMIM: 617684

Protein Summary

• Protein general information: Q9NX58  
  • Name: Cell growth regulating nucleolar protein
  • Length: 379  
  • Mass: 43615
  • Tissue specificity: Predominantly expressed in testis. {ECO
• Sequence:

  MVFFTCNACGESVKKIQVEKHVSVCRNCECLSCIDCGKDFWGDDYKNHVKCISEDQKYGGKGYEGKTHKGDIKQQ
  AWIQKISELIKRPNVSPKVRELLEQISAFDNVPRKKAKFQNWMKNSLKVHNESILDQVWNIFSEASNSEPVNKEQ
  DQRPLHPVANPHAEISTKVPASKVKDAVEQQGEVKKNKRERKEERQKKRKREKKELKLENHQENSRNQKPKKRKK
  GQEADLEAGGEEVPEANGSAGKRSKKKKQRKDSASEEEAHVGAGKRKRRHSEVETDSKKKKMKLPEHPEGGEPED
  DEAPAKGKFNWKGTIKAILKQAPDNEITIKKLRKKVLAQYYTVTDEHHRSEEELLVIFNKKISKNPTFKLLKDKV
  KLVK

• Structural information:
  • Interpro: IPR039999  IPR041010  IPR014898  IPR036236  
  • Prosite: PS51804
  • STRING: ENSP00000345917
• Other Databases: GeneCards:  LYAR  Malacards:  LYAR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003677	DNA binding	IBA	molecular function
GO:0006364	rRNA processing	IBA	biological process
GO:0005730	nucleolus	IBA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0003677	DNA binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0001750	photoreceptor outer segment	ISS	cellular component
GO:0050766	positive regulation of phagocytosis	ISS	biological process
GO:0048821	erythrocyte development	IMP	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006364	rRNA processing	IMP	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0006364	rRNA processing	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0050766	positive regulation of phagocytosis	IEA	biological process
GO:0001750	photoreceptor outer segment	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0001750	photoreceptor outer segment	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R