• Gene id: 5564

Gene Summary

• Gene Symbol: PRKAB1   Gene   UCSC   Ensembl
• Aliases: AMPK, HAMPKb
• Gene name: protein kinase AMP-activated non-catalytic subunit beta 1
• Alternate names: 5'-AMP-activated protein kinase subunit beta-1, 5'-AMP-activated protein kinase beta-1 subunit, AMP-activated protein kinase beta subunit, AMPK beta -1 chain, AMPK beta 1, AMPK subunit beta-1, AMPKb, protein kinase, AMP-activated, beta 1 non-catalytic subunit, pr,
• Gene location: 12q24.23 (119667863: 119681623)     Exons: 8     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha
• OMIM: 602740

Protein Summary

• Protein general information: Q9Y478  
  • Name: 5' AMP activated protein kinase subunit beta 1 (AMPK subunit beta 1) (AMPKb)
  • Length: 270  
  • Mass: 30382
• Sequence:

  MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPA
  QARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVN
  NIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDP
  ALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI

• Structural information:
  • Interpro: IPR032640  IPR039160  IPR006828  IPR037256  IPR013783   IPR014756  
  • PDB: 4CFE 4CFF 4ZHX 5EZV 5ISO 6B1U 6C9F 6C9G 6C9H 6C9J
  • PDBsum: 4CFE 4CFF 4ZHX 5EZV 5ISO 6B1U 6C9F 6C9G 6C9H 6C9J
  • DIP: 39736
  • STRING: ENSP00000229328
• Other Databases: GeneCards:  PRKAB1  Malacards:  PRKAB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031588	nucleotide-activated protein kinase complex	IBA	cellular component
GO:0019901	protein kinase binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0050790	regulation of catalytic activity	IEA	biological process
GO:0006633	fatty acid biosynthetic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007050	cell cycle arrest	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0120162	positive regulation of cold-induced thermogenesis	IEA	biological process
GO:0035878	nail development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0050790	regulation of catalytic activity	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0031588	nucleotide-activated protein kinase complex	IEA	cellular component
GO:0019901	protein kinase binding	IEA	molecular function
GO:0004679	AMP-activated protein kinase activity	IEA	molecular function
GO:0032991	protein-containing complex	IEA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0004672	protein kinase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04714	Thermogenesis
hsa04530	Tight junction
hsa04921	Oxytocin signaling pathway
hsa04932	Non-alcoholic fatty liver disease
hsa04371	Apelin signaling pathway
hsa04910	Insulin signaling pathway
hsa04152	AMPK signaling pathway
hsa04068	FoxO signaling pathway
hsa04922	Glucagon signaling pathway
hsa04931	Insulin resistance
hsa05410	Hypertrophic cardiomyopathy
hsa04211	Longevity regulating pathway
hsa04920	Adipocytokine signaling pathway
hsa04213	Longevity regulating pathway - multiple species
hsa04710	Circadian rhythm

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)