• Gene id: 5563

Gene Summary

• Gene Symbol: PRKAA2   Gene   UCSC   Ensembl
• Aliases: AMPK, AMPK2, AMPKa2, PRKAA
• Gene name: protein kinase AMP-activated catalytic subunit alpha 2
• Alternate names: 5'-AMP-activated protein kinase catalytic subunit alpha-2, 5'-AMP-activated protein kinase, catalytic alpha-2 chain, ACACA kinase, AMP-activated protein kinase alpha-2 subunit variant 2, AMP-activated protein kinase alpha-2 subunit variant 3, AMPK alpha 2, AMPK,
• Gene location: 1p32.2 (56645313: 56715334)     Exons: 12     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a catalytic subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that
• OMIM: 600497

Protein Summary

• Protein general information: P54646  
  • Name: 5' AMP activated protein kinase catalytic subunit alpha 2 (AMPK subunit alpha 2) (EC 2.7.11.1) (Acetyl CoA carboxylase kinase) (ACACA kinase) (EC 2.7.11.27) (Hydroxymethylglutaryl CoA reductase kinase) (HMGCR kinase) (EC 2.7.11.31)
  • Length: 552  
  • Mass: 62320
• Sequence:

  MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGKIKREIQNLKLFRHPH
  IIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAH
  MNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKK
  IRGGVFYIPEYLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF
  ECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPPLIA
  DSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVYRAMKQLDFEWKVVNAYHLRVRRKNPVTGNY
  VKMSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTL
  SSVSPRLGSHTMDFFEMCASLITTLAR

• Structural information:
  • Protein Domains: (16..26-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR032270  IPR039148  IPR028375  IPR011009  IPR000719   IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • CDD: cd12200
  • PDB: 2H6D 2LTU 2YZA 3AQV 4CFE 4CFF 4ZHX 5EZV 5ISO 6B1U 6B2E 6BX6
  • PDBsum: 2H6D 2LTU 2YZA 3AQV 4CFE 4CFF 4ZHX 5EZV 5ISO 6B1U 6B2E 6BX6
  • DIP: 39796
  • STRING: ENSP00000360290
• Other Databases: GeneCards:  PRKAA2  Malacards:  PRKAA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004679	AMP-activated protein kinase activity	ISS	molecular function
GO:0004679	AMP-activated protein kinase activity	ISS	molecular function
GO:1904428	negative regulation of tubulin deacetylation	ISS	biological process
GO:2000758	positive regulation of peptidyl-lysine acetylation	ISS	biological process
GO:0030424	axon	ISS	cellular component
GO:0010494	cytoplasmic stress granule	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:1903829	positive regulation of cellular protein localization	ISS	biological process
GO:0070507	regulation of microtubule cytoskeleton organization	ISS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0043025	neuronal cell body	ISS	cellular component
GO:0010629	negative regulation of gene expression	ISS	biological process
GO:0071277	cellular response to calcium ion	ISS	biological process
GO:0071333	cellular response to glucose stimulus	ISS	biological process
GO:0034599	cellular response to oxidative stress	ISS	biological process
GO:0016239	positive regulation of macroautophagy	TAS	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0006468	protein phosphorylation	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0004679	AMP-activated protein kinase activity	IDA	molecular function
GO:0016241	regulation of macroautophagy	ISS	biological process
GO:0045821	positive regulation of glycolytic process	ISS	biological process
GO:0043066	negative regulation of apoptotic process	ISS	biological process
GO:0042593	glucose homeostasis	ISS	biological process
GO:0042149	cellular response to glucose starvation	ISS	biological process
GO:0035174	histone serine kinase activity	ISS	molecular function
GO:0008610	lipid biosynthetic process	ISS	biological process
GO:0003682	chromatin binding	ISS	molecular function
GO:0097009	energy homeostasis	ISS	biological process
GO:0055089	fatty acid homeostasis	ISS	biological process
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0032007	negative regulation of TOR signaling	ISS	biological process
GO:0031669	cellular response to nutrient levels	ISS	biological process
GO:0010508	positive regulation of autophagy	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004674	protein serine/threonine kinase activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004679	AMP-activated protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006695	cholesterol biosynthetic process	IEA	biological process
GO:0006633	fatty acid biosynthetic process	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0008202	steroid metabolic process	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0016126	sterol biosynthetic process	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0008203	cholesterol metabolic process	IEA	biological process
GO:0006694	steroid biosynthetic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0050405	[acetyl-CoA carboxylase] kinase activity	IEA	molecular function
GO:0047322	[hydroxymethylglutaryl-CoA reductase (NADPH)] kinase activity	IEA	molecular function
GO:0004712	protein serine/threonine/tyrosine kinase activity	IDA	molecular function
GO:0006853	carnitine shuttle	TAS	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0042304	regulation of fatty acid biosynthetic process	TAS	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007050	cell cycle arrest	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1904428	negative regulation of tubulin deacetylation	IEA	biological process
GO:1903829	positive regulation of cellular protein localization	IEA	biological process
GO:0071380	cellular response to prostaglandin E stimulus	IEA	biological process
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:0071277	cellular response to calcium ion	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0042149	cellular response to glucose starvation	IEA	biological process
GO:0035690	cellular response to drug	IEA	biological process
GO:0035174	histone serine kinase activity	IEA	molecular function
GO:0034599	cellular response to oxidative stress	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0016241	regulation of macroautophagy	IEA	biological process
GO:0014850	response to muscle activity	IEA	biological process
GO:0010494	cytoplasmic stress granule	IEA	cellular component
GO:0008610	lipid biosynthetic process	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:2000758	positive regulation of peptidyl-lysine acetylation	IEA	biological process
GO:0070507	regulation of microtubule cytoskeleton organization	IEA	biological process
GO:0062028	regulation of stress granule assembly	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0042752	regulation of circadian rhythm	IEA	biological process
GO:0032007	negative regulation of TOR signaling	IEA	biological process
GO:0031669	cellular response to nutrient levels	IEA	biological process
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0010508	positive regulation of autophagy	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0004679	AMP-activated protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0035404	histone-serine phosphorylation	IEA	biological process
GO:0035404	histone-serine phosphorylation	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04714	Thermogenesis
hsa04530	Tight junction
hsa04150	mTOR signaling pathway
hsa04140	Autophagy - animal
hsa04921	Oxytocin signaling pathway
hsa04932	Non-alcoholic fatty liver disease
hsa04371	Apelin signaling pathway
hsa04910	Insulin signaling pathway
hsa05418	Fluid shear stress and atherosclerosis
hsa04152	AMPK signaling pathway
hsa04068	FoxO signaling pathway
hsa04922	Glucagon signaling pathway
hsa04931	Insulin resistance
hsa05410	Hypertrophic cardiomyopathy
hsa04211	Longevity regulating pathway
hsa04920	Adipocytokine signaling pathway
hsa04213	Longevity regulating pathway - multiple species
hsa04710	Circadian rhythm

Diseases

Associated diseases	References
type 2 diabetes mellitus	PMID:16567511
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881