• Gene id: 55629

Gene Summary

• Gene Symbol: PNRC2   Gene   UCSC   Ensembl
• Gene name: proline rich nuclear receptor coactivator 2
• Alternate names: proline-rich nuclear receptor coactivator 2,
• Gene location: 1p36.11 (111842227: 111902221)     Exons: 16     NC_000012.12
• OMIM: 611882

Protein Summary

• Protein general information: Q9NPJ4  
  • Name: Proline rich nuclear receptor coactivator 2
  • Length: 139  
  • Mass: 15591
  • Tissue specificity: Expressed in heart, lung, muscle and brain. {ECO
• Sequence:

  MGGGERYNIPAPQSRNVSKNQQQLNRQKTKEQNSQMKIVHKKKERGHGYNSSAAAWQAMQNGGKNKNFPNNQSWN
  SSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFNPSDKEIMTFQLKTLLKVQV

• Structural information:
  • Interpro: IPR026780  IPR026781  
  • PDB: 4B6H 5KQ1 5KQ4
  • PDBsum: 4B6H 5KQ1 5KQ4
  • DIP: 41328
  • STRING: ENSP00000334840
• Other Databases: GeneCards:  PNRC2  Malacards:  PNRC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000932	P-body	IBA	cellular component
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000932	P-body	IDA	cellular component
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0031087	deadenylation-independent decapping of nuclear-transcribed mRNA	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IEA	biological process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000932	P-body	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)