• Gene id: 55625

Gene Summary

• Gene Symbol: ZDHHC7   Gene   UCSC   Ensembl
• Aliases: DHHC7, SERZ-B, SERZ1, ZNF370
• Gene name: zinc finger DHHC-type palmitoyltransferase 7
• Alternate names: palmitoyltransferase ZDHHC7, DHHC-7, Sertoli cell gene with zinc finger domain-I(2), Sertoli cell gene with zinc finger domain-beta, zinc finger DHHC domain-containing protein 7, zinc finger DHHC-type containing 7, zinc finger protein 370, zinc finger, DHHC doma,
• Gene location: 16q24.1 (85011534: 84974174)     Exons: 10     NC_000016.10
• OMIM: 109195

Protein Summary

• Protein general information: Q9NXF8  
  • Name: Palmitoyltransferase ZDHHC7 (EC 2.3.1.225) (Zinc finger DHHC domain containing protein 7) (DHHC 7)
  • Length: 308  
  • Mass: 35140
• Sequence:

  MQPSGHRLRDVEHHPLLAENDNYDSSSSSSSEADVADRVWFIRDGCGMICAVMTWLLVAYADFVVTFVMLLPSKD
  FWYSVVNGVIFNCLAVLALSSHLRTMLTDPGAVPKGNATKEYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICK
  RCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHALILCGFQFISCVRGQWTECSDFSPPITVILLIFLCL
  EGLLFFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPR
  KGGPEFSV

• Structural information:
  • Protein Domains: (130..18-)
    (/note="DHHC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00067"-)
  • Interpro: IPR001594  
  • Prosite: PS50216
• Other Databases: GeneCards:  ZDHHC7  Malacards:  ZDHHC7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006612	protein targeting to membrane	IBA	biological process
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IBA	molecular function
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IBA	biological process
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IDA	molecular function
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IDA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0008277	regulation of G protein-coupled receptor signaling pathway	IMP	biological process
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IMP	biological process
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IMP	molecular function
GO:0009895	negative regulation of catabolic process	IMP	biological process
GO:0030859	polarized epithelial cell differentiation	IMP	biological process
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IMP	biological process
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IMP	molecular function
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IMP	biological process
GO:1903076	regulation of protein localization to plasma membrane	IMP	biological process
GO:0018345	protein palmitoylation	IMP	biological process
GO:0044381	glucose import in response to insulin stimulus	ISS	biological process
GO:1902044	regulation of Fas signaling pathway	IMP	biological process
GO:0150106	regulation of protein localization to cell-cell junction	IMP	biological process
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IEA	molecular function
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IEA	molecular function
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:1903076	regulation of protein localization to plasma membrane	IEA	biological process
GO:0044381	glucose import in response to insulin stimulus	IEA	biological process
GO:0018345	protein palmitoylation	IEA	biological process
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0018345	protein palmitoylation	IDA	biological process
GO:0016409	palmitoyltransferase activity	IDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881