• Gene id: 55617

Gene Summary

• Gene Symbol: TASP1   Gene   UCSC   Ensembl
• Aliases: C20orf13, dJ585I14.2
• Gene name: taspase 1
• Alternate names: threonine aspartase 1,
• Gene location: 20p12.1 (13638935: 13104759)     Exons: 24     NC_000020.11
• Gene summary(Entrez): This gene encodes an endopeptidase that cleaves specific substrates following aspartate residues. The encoded protein undergoes posttranslational autoproteolytic processing to generate alpha and beta subunits, which reassemble into the active alpha2-beta2
• OMIM: 610684

Protein Summary

• Protein general information: Q9H6P5  
  • Name: Threonine aspartase 1 (Taspase 1) (EC 3.4.25. ) [Cleaved into: Threonine aspartase subunit alpha; Threonine aspartase subunit beta]
  • Length: 420  
  • Mass: 44455
• Sequence:

  MTMEKGMSSGEGLPSRSSQVSAGKITAKELETKQSYKEKRGGFVLVHAGAGYHSESKAKEYKHVCKRACQKAIEK
  LQAGALATDAVTAALVELEDSPFTNAGMGSNLNLLGEIECDASIMDGKSLNFGAVGALSGIKNPVSVANRLLCEG
  QKGKLSAGRIPPCFLVGEGAYRWAVDHGIPSCPPNIMTTRFSLAAFKRNKRKLELAERVDTDFMQLKKRRQSSEK
  ENDSGTLDTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHNPYSTAVSTSGCGEHLVRT
  ILARECSHALQAEDAHQALLETMQNKFISSPFLASEDGVLGGVIVLRSCRCSAEPDSSQNKQTLLVEFLWSHTTE
  SMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAIEGGVCRLESPVN

• Structural information:
  • Interpro: IPR029055  IPR000246  IPR037464  
  • CDD: cd04514
  • PDB: 2A8I 2A8J 2A8L 2A8M
  • PDBsum: 2A8I 2A8J 2A8L 2A8M
  • DIP: 48456
  • STRING: ENSP00000338624
• Other Databases: GeneCards:  TASP1  Malacards:  TASP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IMP	biological process
GO:0051604	protein maturation	IBA	biological process
GO:0004298	threonine-type endopeptidase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0004298	threonine-type endopeptidase activity	IMP	molecular function
GO:0004298	threonine-type endopeptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004298	threonine-type endopeptidase activity	IEA	molecular function
GO:0042802	identical protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881