• Gene id: 55616

Gene Summary

• Gene Symbol: ASAP3   Gene   UCSC   Ensembl
• Aliases: ACAP4, CENTB6, DDEFL1, UPLC1
• Gene name: ArfGAP with SH3 domain, ankyrin repeat and PH domain 3
• Alternate names: arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3, ARF6 GTPase-activating protein, ArfGAP with SH3 domain, ankyrin repeat and PH domain 3 1, centaurin, beta 6, development and differentiation enhancing factor-like 1, protein up-regulated i,
• Gene location: 1p36.12 (23484630: 23428562)     Exons: 26     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of a subfamily of ADP-ribosylation factor(Arf) GTPase-activating proteins that contain additional ankyrin repeat and pleckstrin homology domains. The Arf GAP domain of this protein catalyzes the hydrolysis of GTP bound to Arf pr
• OMIM: 610007

Protein Summary

• Protein general information: Q8TDY4  
  • Name: Arf GAP with SH3 domain, ANK repeat and PH domain containing protein 3 (Development and differentiation enhancing factor like 1) (Protein up regulated in liver cancer 1)
  • Length: 903  
  • Mass: 99155
  • Tissue specificity: Highly expressed in primary hepatocarcinoma. Detected in lung, liver and blood leukocytes. {ECO
• Sequence:

  MPEQFSVAEFLAVTAEDLSSPAGAAAFAAKMPRYRGAALAREEILEGDQAILQRIKKAVRAIHSSGLGHVENEEQ
  YREAVESLGNSHLSQNSHELSTGFLNLAVFTREVAALFKNLIQNLNNIVSFPLDSLMKGQLRDGRQDSKKQLEKA
  WKDYEAKMAKLEKERDRARVTGGIPGEVAQDMQRERRIFQLHMCEYLLKAGESQMKQGPDFLQSLIKFFHAQHNF
  FQDGWKAAQSLFPFIEKLAASVHALHQAQEDELQKLTQLRDSLRGTLQLESREEHLSRKNSGCGYSIHQHQGNKQ
  FGTEKVGFLYKKSDGIRRVWQKRKCGVKYGCLTISHSTINRPPVKLTLLTCQVRPNPEEKKCFDLVTHNRTYHFQ
  AEDEHECEAWVSVLQNSKDEALSSAFLGEPSAGPGSWGSAGHDGEPHDLTKLLIAEVKSRPGNSQCCDCGAADPT
  WLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMG
  TRRDYIMAKYVEHRFARRCTPEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQA
  SLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLE
  QAQAGTFAFPLHVDYSWVISTEPGSDSEEDEEEKRCLLKLPAQAHWASGRLDISNKTYETVASLGAATPQGESED
  CPPPLPVKNSSRTLVQGCARHASGDRSEVSSLSSEAPETPESLGSPASSSSLMSPLEPGDPSQAPPNSEEGLREP
  PGTSRPSLTSGTTPSEMYLPVRFSSESTRSYRRGARSPEDGPSARQPLPRRNVPVGITEGDGSRTGSLPASSVQL
  LQD

• Structural information:
  • Protein Domains: (302..39-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (426..55-)
    (/note="Arf-GAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00288"-)
  • Interpro: IPR027267  IPR002110  IPR020683  IPR036770  IPR037278   IPR001164  IPR038508  IPR028775  IPR011993  IPR037844  IPR001849  
  • Prosite: PS50297 PS50088 PS50115 PS50003
  • CDD: cd13251
  • PDB: 2B0O 3LVQ 3LVR
  • PDBsum: 2B0O 3LVQ 3LVR
  • STRING: ENSP00000338769
• Other Databases: GeneCards:  ASAP3  Malacards:  ASAP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051492	regulation of stress fiber assembly	IBA	biological process
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0001726	ruffle	IBA	cellular component
GO:0005925	focal adhesion	IBA	cellular component
GO:0005096	GTPase activator activity	IBA	molecular function
GO:0001726	ruffle	IDA	cellular component
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0005925	focal adhesion	IDA	cellular component
GO:0051492	regulation of stress fiber assembly	IMP	biological process
GO:0016477	cell migration	IMP	biological process
GO:0016477	cell migration	IEA	biological process
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005925	focal adhesion	IEA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0051492	regulation of stress fiber assembly	IBA	biological process
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0001726	ruffle	IBA	cellular component
GO:0005925	focal adhesion	IBA	cellular component
GO:0005096	GTPase activator activity	IBA	molecular function
GO:0001726	ruffle	IDA	cellular component
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0005925	focal adhesion	IDA	cellular component
GO:0051492	regulation of stress fiber assembly	IMP	biological process
GO:0016477	cell migration	IMP	biological process
GO:0016477	cell migration	IEA	biological process
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005925	focal adhesion	IEA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04666	Fc gamma R-mediated phagocytosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881