• Gene id: 55614

Gene Summary

• Gene Symbol: KIF16B   Gene   UCSC   Ensembl
• Aliases: C20orf23, KISC20ORF, SNX23
• Gene name: kinesin family member 16B
• Alternate names: kinesin-like protein KIF16B, kinesin motor protein, sorting nexin 23, testis secretory sperm-binding protein Li 201a,
• Gene location: 20p12.1 (16573456: 16272103)     Exons: 29     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is a kinesin-like protein that may be involved in intracellular trafficking. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2010]
• OMIM: 618171

SNPs

rs12625552

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000020.11   g.16427627A>G
NC_000020.10   g.16408272A>G
NG_028043.2   g.150808T>C
NG_028043.1   g.150808T>C|SEQ=[A/G]|GENE=KIF16B

Protein Summary

• Protein general information: Q96L93  
  • Name: Kinesin like protein KIF16B (Sorting nexin 23)
  • Length: 1317  
  • Mass: 152011
  • Tissue specificity: Primarily expressed in brain. Also present in kidney, liver, intestine, placenta, leukocytes, heart and skeletal muscle (at protein level). {ECO
• Sequence:

  MASVKVAVRVRPMNRREKDLEAKFIIQMEKSKTTITNLKIPEGGTGDSGRERTKTFTYDFSFYSADTKSPDYVSQ
  EMVFKTLGTDVVKSAFEGYNACVFAYGQTGSGKSYTMMGNSGDSGLIPRICEGLFSRINETTRWDEASFRTEVSY
  LEIYNERVRDLLRRKSSKTFNLRVREHPKEGPYVEDLSKHLVQNYGDVEELMDAGNINRTTAATGMNDVSSRSHA
  IFTIKFTQAKFDSEMPCETVSKIHLVDLAGSERADATGATGVRLKEGGNINKSLVTLGNVISALADLSQDAANTL
  AKKKQVFVPYRDSVLTWLLKDSLGGNSKTIMIATISPADVNYGETLSTLRYANRAKNIINKPTINEDANVKLIRE
  LRAEIARLKTLLAQGNQIALLDSPTALSMEEKLQQNEARVQELTKEWTNKWNETQNILKEQTLALRKEGIGVVLD
  SELPHLIGIDDDLLSTGIILYHLKEGQTYVGRDDASTEQDIVLHGLDLESEHCIFENIGGTVTLIPLSGSQCSVN
  GVQIVEATHLNQGAVILLGRTNMFRFNHPKEAAKLREKRKSGLLSSFSLSMTDLSKSRENLSAVMLYNPGLEFER
  QQREELEKLESKRKLIEEMEEKQKSDKAELERMQQEVETQRKETEIVQLQIRKQEESLKRRSFHIENKLKDLLAE
  KEKFEEERLREQQEIELQKKRQEEETFLRVQEELQRLKELNNNEKAEKFQIFQELDQLQKEKDEQYAKLELEKKR
  LEEQEKEQVMLVAHLEEQLREKQEMIQLLRRGEVQWVEEEKRDLEGIRESLLRVKEARAGGDEDGEELEKAQLRF
  FEFKRRQLVKLVNLEKDLVQQKDILKKEVQEEQEILECLKCEHDKESRLLEKHDESVTDVTEVPQDFEKIKPVEY
  RLQYKERQLQYLLQNHLPTLLEEKQRAFEILDRGPLSLDNTLYQVEKEMEEKEEQLAQYQANANQLQKLQATFEF
  TANIARQEEKVRKKEKEILESREKQQREALERALARLERRHSALQRHSTLGMEIEEQRQKLASLNSGSREQSGLQ
  ASLEAEQEALEKDQERLEYEIQQLKQKIYEVDGVQKDHHGTLEGKVASSSLPVSAEKSHLVPLMDARINAYIEEE
  VQRRLQDLHRVISEGCSTSADTMKDNEKLHNGTIQRKLKYERMVSRSLGANPDDLKDPIKISIPRYVLCGQGKDA
  HFEFEVKITVLDETWTVFRRYSRFREMHKTLKLKYAELAALEFPPKKLFGNKDERVIAERRSHLEKYLRDFFSVM
  LQSATSPLHINKVGLTLSKHTICEFSPFFKKGVFDYSSHGTG

• Structural information:
  • Protein Domains: (3..35-)
    (/note="Kinesin-motor)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00283-)
    (478..52-)
    (/note="FHA-)
    (1182..129-)
    (/note="PX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00147"-)
  • Interpro: IPR000253  IPR027640  IPR019821  IPR001752  IPR036961   IPR027417  IPR001683  IPR036871  IPR008984  
  • Prosite: PS00411 PS50067 PS50195
  • PDB: 2V14 6EE0
  • PDBsum: 2V14 6EE0
  • STRING: ENSP00000384164
• Other Databases: GeneCards:  KIF16B  Malacards:  KIF16B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005874	microtubule	IBA	cellular component
GO:0008574	ATP-dependent microtubule motor activity, plus-end-directed	IBA	molecular function
GO:0016887	ATPase activity	IBA	molecular function
GO:0003777	microtubule motor activity	IBA	molecular function
GO:0005871	kinesin complex	IBA	cellular component
GO:0007018	microtubule-based movement	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0080025	phosphatidylinositol-3,5-bisphosphate binding	IDA	molecular function
GO:0005768	endosome	IDA	cellular component
GO:0043325	phosphatidylinositol-3,4-bisphosphate binding	IDA	molecular function
GO:0043325	phosphatidylinositol-3,4-bisphosphate binding	IDA	molecular function
GO:0032266	phosphatidylinositol-3-phosphate binding	IDA	molecular function
GO:0008574	ATP-dependent microtubule motor activity, plus-end-directed	IDA	molecular function
GO:0005769	early endosome	IDA	cellular component
GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding	IDA	molecular function
GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding	IDA	molecular function
GO:0032801	receptor catabolic process	IMP	biological process
GO:0007492	endoderm development	ISS	biological process
GO:0045022	early endosome to late endosome transport	IMP	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	ISS	biological process
GO:0007173	epidermal growth factor receptor signaling pathway	IMP	biological process
GO:0006895	Golgi to endosome transport	ISS	biological process
GO:0001919	regulation of receptor recycling	IMP	biological process
GO:0001704	formation of primary germ layer	ISS	biological process
GO:0003777	microtubule motor activity	IEA	molecular function
GO:0007018	microtubule-based movement	IEA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0035091	phosphatidylinositol binding	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0071346	cellular response to interferon-gamma	IEA	biological process
GO:0017137	Rab GTPase binding	IEA	molecular function
GO:0007492	endoderm development	IEA	biological process
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0008543	fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0006895	Golgi to endosome transport	IEA	biological process
GO:0001704	formation of primary germ layer	IEA	biological process
GO:0031901	early endosome membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881