• Gene id: 55603

Gene Summary

• Gene Symbol: TENT5A   Gene   UCSC   Ensembl
• Aliases: C6orf37, FAM46A, OI18, XTP11
• Gene name: terminal nucleotidyltransferase 5A
• Alternate names: terminal nucleotidyltransferase 5A, HBV X-transactivated gene 11 protein, HBV XAg-transactivated protein 11, family with sequence similarity 46 member A, protein FAM46A, putative nucleotidyltransferase FAM46A, retinal expressed gene C6orf37,
• Gene location: 6q14.1 (81752680: 81745729)     Exons: 3     NC_000006.12
• OMIM: 611357

Protein Summary

• Protein general information: Q96IP4  
  • Name: Terminal nucleotidyltransferase 5A (EC 2.7.7. ) (HBV X transactivated gene 11 protein) (HBV XAg transactivated protein 11)
  • Length: 442  
  • Mass: 49666
  • Tissue specificity: Widely expressed, with preferential expression observed in the retina compared to other ocular tissues (PubMed
• Sequence:

  MAEGEGYFAMSEDELACSPYIPLGGDFGGGDFGGGDFGGGDFGGGGSFGGHCLDYCESPTAHCNVLNWEQVQRLD
  GILSETIPIHGRGNFPTLELQPSLIVKVVRRRLAEKRIGVRDVRLNGSAASHVLHQDSGLGYKDLDLIFCADLRG
  EGEFQTVKDVVLDCLLDFLPEGVNKEKITPLTLKEAYVQKMVKVCNDSDRWSLISLSNNSGKNVELKFVDSLRRQ
  FEFSVDSFQIKLDSLLLFYECSENPMTETFHPTIIGESVYGDFQEAFDHLCNKIIATRNPEEIRGGGLLKYCNLL
  VRGFRPASDEIKTLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDRKYEYLMTLHGVVNESTVCLMGHERR
  QTLNLITMLAIRVLADQNVIPNVANVTCYYQPAPYVADANFSNYYIAQVQPVFTCQQQTYSTWLPCN

• Structural information:
  • Interpro: IPR012937  
  • STRING: ENSP00000318298
• Other Databases: GeneCards:  TENT5A  Malacards:  TENT5A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009617	response to bacterium	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0048255	mRNA stabilization	IBA	biological process
GO:1990817	RNA adenylyltransferase activity	IBA	molecular function
GO:1990817	RNA adenylyltransferase activity	IEA	molecular function
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function

Diseases

Associated diseases	References
lung non-small cell carcinoma	PMID:25884493
Osteoarthritis	PMID:25231575
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)