• Gene id: 55600

Gene Summary

• Gene Symbol: ITLN1   Gene   UCSC   Ensembl
• Aliases: HL-1, HL1, INTL, ITLN, LFR, hIntL, omentin
• Gene name: intelectin 1
• Alternate names: intelectin-1, ITLN-1, endothelial lectin HL-1, galactofuranose-binding lectin, intelectin 1 (galactofuranose binding), intestinal lactoferrin receptor,
• Gene location: 1q23.3 (160885179: 160876539)     Exons: 8     NC_000001.11
• OMIM: 603672

Protein Summary

• Protein general information: Q8WWA0  
  • Name: Intelectin 1 (ITLN 1) (Endothelial lectin HL 1) (Galactofuranose binding lectin) (Intestinal lactoferrin receptor) (Omentin)
  • Length: 313  
  • Mass: 34962
  • Tissue specificity: Highly expressed in omental adipose tissue where it is found in stromal vascular cells but not in fat cells but is barely detectable in subcutaneous adipose tissue (at protein level) (PubMed
• Sequence:

  MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSG
  GGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIW
  HVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSP
  YGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYSSS
  REITEAAVLLFYR

• Structural information:
  • Protein Domains: (32..25-)
    (/note="Fibrinogen-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00739"-)
  • Interpro: IPR036056  IPR014716  IPR002181  
  • Prosite: PS51406
  • PDB: 4WMQ 4WMY 6USC
  • PDBsum: 4WMQ 4WMY 6USC
  • DIP: 61704
  • STRING: ENSP00000323587
• Other Databases: GeneCards:  ITLN1  Malacards:  ITLN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070207	protein homotrimerization	IDA	biological process
GO:0005509	calcium ion binding	IDA	molecular function
GO:0070492	oligosaccharide binding	IDA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0019730	antimicrobial humoral response	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0046326	positive regulation of glucose import	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0009624	response to nematode	ISS	biological process
GO:0031526	brush border membrane	ISS	cellular component
GO:0045121	membrane raft	ISS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881