About Us

Search Result


Gene id 55585
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol UBE2Q1   Gene   UCSC   Ensembl
Aliases GTAP, NICE-5, NICE5, PRO3094, UBE2Q
Gene name ubiquitin conjugating enzyme E2 Q1
Alternate names ubiquitin-conjugating enzyme E2 Q1, E2 ubiquitin-conjugating enzyme Q1, galactosyl transferase-associated protein, protein NICE-5, ubiquitin carrier protein Q1, ubiquitin conjugating enzyme E2Q family member 1, ubiquitin-conjugating enzyme E2Q (putative) 1, ubiq,
Gene location 1q21.3 (15585050: 15571698)     Exons: 7     NC_000001.11
Gene summary(Entrez) The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjuga
OMIM 617429

Protein Summary

Protein general information Q7Z7E8  

Name: Ubiquitin conjugating enzyme E2 Q1 (EC 2.3.2.23) (E2 ubiquitin conjugating enzyme Q1) (Protein NICE 5) (Ubiquitin carrier protein Q1) (Ubiquitin protein ligase Q1)

Length: 422  Mass: 46127

Tissue specificity: Widely expressed. {ECO

Sequence MQQPQPQGQQQPGPGQQLGGQGAAPGAGGGPGGGPGPGPCLRRELKLLESIFHRGHERFRIASACLDELSCEFLL
AGAGGAGAGAAPGPHLPPRGSVPGDPVRIHCNITESYPAVPPIWSVESDDPNLAAVLERLVDIKKGNTLLLQHLK
RIISDLCKLYNLPQHPDVEMLDQPLPAEQCTQEDVSSEDEDEEMPEDTEDLDHYEMKEEEPAEGKKSEDDGIGKE
NLAILEKIKKNQRQDYLNGAVSGSVQATDRLMKELRDIYRSQSFKGGNYAVELVNDSLYDWNVKLLKVDQDSALH
NDLQILKEKEGADFILLNFSFKDNFPFDPPFVRVVSPVLSGGYVLGGGAICMELLTKQGWSSAYSIESVIMQISA
TLVKGKARVQFGANKSQYSLTRAQQSYKSLVQIHEKNGWYTPPKEDG
Structural information
Interpro:  IPR000608  IPR016135  
Prosite:   PS50127

PDB:  
2QGX
PDBsum:   2QGX
MINT:  
STRING:   ENSP00000292211
Other Databases GeneCards:  UBE2Q1  Malacards:  UBE2Q1

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0000209 protein polyubiquitinatio
n
IBA biological process
GO:0005634 nucleus
IBA cellular component
GO:0061631 ubiquitin conjugating enz
yme activity
IBA molecular function
GO:0016740 transferase activity
IEA molecular function
GO:0042995 cell projection
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0000166 nucleotide binding
IEA molecular function
GO:0005524 ATP binding
IEA molecular function
GO:0061631 ubiquitin conjugating enz
yme activity
IEA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0009566 fertilization
IEA biological process
GO:0007617 mating behavior
IEA biological process
GO:0007566 embryo implantation
IEA biological process
GO:0070459 prolactin secretion
IEA biological process
GO:0061631 ubiquitin conjugating enz
yme activity
IEA molecular function
GO:0061458 reproductive system devel
opment
IEA biological process
GO:0001967 suckling behavior
IEA biological process
GO:0030175 filopodium
IEA cellular component
GO:0005829 cytosol
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0016567 protein ubiquitination
IEA biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04120Ubiquitin mediated proteolysis
Associated diseases References
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract