• Gene id: 5558

Gene Summary

• Gene Symbol: PRIM2   Gene   UCSC   Ensembl
• Aliases: PRIM2A, p58
• Gene name: DNA primase subunit 2
• Alternate names: DNA primase large subunit, DNA primase 58 kDa subunit, primase (DNA) subunit 2, primase, DNA, polypeptide 2 (58kDa),
• Gene location: 6p11.2 (81096394: 81081944)     Exons: 6     NC_000016.10
• Gene summary(Entrez): This gene encodes the 58 kilodalton subunit of DNA primase, an enzyme that plays a key role in the replication of DNA. The encoded protein forms a heterodimer with a 49 kilodalton subunit. This heterodimer functions as a DNA-directed RNA polymerase to syn
• OMIM: 176636

Protein Summary

• Protein general information: P49643  
  • Name: DNA primase large subunit (DNA primase 58 kDa subunit) (p58)
  • Length: 509  
  • Mass: 58806
• Sequence:

  MEFSGRKWRKLRLAGDQRNASYPHCLQFYLQPPSENISLIEFENLAIDRVKLLKSVENLGVSYVKGTEQYQSKLE
  SELRKLKFSYRENLEDEYEPRRRDHISHFILRLAYCQSEELRRWFIQQEMDLLRFRFSILPKDKIQDFLKDSQLQ
  FEAISDEEKTLREQEIVASSPSLSGLKLGFESIYKIPFADALDLFRGRKVYLEDGFAYVPLKDIVAIILNEFRAK
  LSKALALTARSLPAVQSDERLQPLLNHLSHSYTGQDYSTQGNVGKISLDQIDLLSTKSFPPCMRQLHKALRENHH
  LRHGGRMQYGLFLKGIGLTLEQALQFWKQEFIKGKMDPDKFDKGYSYNIRHSFGKEGKRTDYTPFSCLKIILSNP
  PSQGDYHGCPFRHSDPELLKQKLQSYKISPGGISQILDLVKGTHYQVACQKYFEMIHNVDDCGFSLNHPNQFFCE
  SQRILNGGKDIKKEPIQPETPQPKPSVQKTKDASSALASLNSSLEMDMEGLEDYFSEDS

• Structural information:
  • Interpro: IPR016558  IPR007238  
  • CDD: cd07322
  • PDB: 3L9Q 3Q36 4BPU 4BPW 4BPX 4RR2 5DQO 5EXR 5F0Q 5F0S 5I7M 6DHW
  • PDBsum: 3L9Q 3Q36 4BPU 4BPW 4BPX 4RR2 5DQO 5EXR 5F0Q 5F0S 5I7M 6DHW
  • DIP: 36438
  • STRING: ENSP00000484105
• Other Databases: GeneCards:  PRIM2  Malacards:  PRIM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005658	alpha DNA polymerase:primase complex	IBA	cellular component
GO:0006269	DNA replication, synthesis of RNA primer	IEA	biological process
GO:0006260	DNA replication	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0006269	DNA replication, synthesis of RNA primer	IEA	biological process
GO:0051539	4 iron, 4 sulfur cluster binding	IEA	molecular function
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003896	DNA primase activity	TAS	molecular function
GO:0006269	DNA replication, synthesis of RNA primer	TAS	biological process
GO:0006270	DNA replication initiation	TAS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0032201	telomere maintenance via semi-conservative replication	TAS	biological process
GO:0032201	telomere maintenance via semi-conservative replication	TAS	biological process
GO:0032201	telomere maintenance via semi-conservative replication	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03030	DNA replication

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray