• Gene id: 55577

Gene Summary

• Gene Symbol: NAGK   Gene   UCSC   Ensembl
• Aliases: GNK, HSA242910
• Gene name: N-acetylglucosamine kinase
• Alternate names: N-acetyl-D-glucosamine kinase, epididymis secretory sperm binding protein, glcNAc kinase,
• Gene location: 2p13.3 (71068277: 71079807)     Exons: 9     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the N-acetylhexosamine kinase family. The encoded protein catalyzes the conversion of N-acetyl-D-glucosamine to N-acetyl-D-glucosamine 6-phosphate, and is the major mammalian enzyme which recovers amino sugars. [provided by R
• OMIM: 606828

Protein Summary

• Protein general information: Q9UJ70  
  • Name: N acetyl D glucosamine kinase (N acetylglucosamine kinase) (EC 2.7.1.59) (GlcNAc kinase)
  • Length: 344  
  • Mass: 37376
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSL
  SGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMM
  GDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQ
  QGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFS
  SFTLMKLRHSSALGGASLGARHIGHLLPMDYSANAIAFYSYTFS

• Structural information:
  • Interpro: IPR002731  IPR039758  
  • PDB: 2CH5 2CH6
  • PDBsum: 2CH5 2CH6
  • STRING: ENSP00000477639
• Other Databases: GeneCards:  NAGK  Malacards:  NAGK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045127	N-acetylglucosamine kinase activity	IBA	molecular function
GO:0045127	N-acetylglucosamine kinase activity	IDA	molecular function
GO:0019262	N-acetylneuraminate catabolic process	TAS	biological process
GO:0045127	N-acetylglucosamine kinase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0006051	N-acetylmannosamine metabolic process	TAS	biological process
GO:0006044	N-acetylglucosamine metabolic process	TAS	biological process
GO:0045127	N-acetylglucosamine kinase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006048	UDP-N-acetylglucosamine biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046835	carbohydrate phosphorylation	IEA	biological process
GO:0046835	carbohydrate phosphorylation	IEA	biological process
GO:0046835	carbohydrate phosphorylation	IEA	biological process
GO:0046835	carbohydrate phosphorylation	IEA	biological process
GO:0019262	N-acetylneuraminate catabolic process	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00520	Amino sugar and nucleotide sugar metabolism

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R