• Gene id: 55572

Gene Summary

• Gene Symbol: FOXRED1   Gene   UCSC   Ensembl
• Aliases: FP634, H17, MC1DN19
• Gene name: FAD dependent oxidoreductase domain containing 1
• Alternate names: FAD-dependent oxidoreductase domain-containing protein 1,
• Gene location: 11q24.2 (126269042: 126278131)     Exons: 12     NC_000011.10
• Gene summary(Entrez): This gene encodes a protein that contains a FAD-dependent oxidoreductase domain. The encoded protein is localized to the mitochondria and may function as a chaperone protein required for the function of mitochondrial complex I. Mutations in this gene are
• OMIM: 614917

Protein Summary

• Protein general information: Q96CU9  
  • Name: FAD dependent oxidoreductase domain containing protein 1 (EC 1. . . )
  • Length: 486  
  • Mass: 53812
• Sequence:

  MIRRVLPHGMGRGLLTRRPGTRRGGFSLDWDGKVSEIKKKIKSILPGRSCDLLQDTSHLPPEHSDVVIVGGGVLG
  LSVAYWLKKLESRRGAIRVLVVERDHTYSQASTGLSVGGICQQFSLPENIQLSLFSASFLRNINEYLAVVDAPPL
  DLRFNPSGYLLLASEKDAAAMESNVKVQRQEGAKVSLMSPDQLRNKFPWINTEGVALASYGMEDEGWFDPWCLLQ
  GLRRKVQSLGVLFCQGEVTRFVSSSQRMLTTDDKAVVLKRIHEVHVKMDRSLEYQPVECAIVINAAGAWSAQIAA
  LAGVGEGPPGTLQGTKLPVEPRKRYVYVWHCPQGPGLETPLVADTSGAYFRREGLGSNYLGGRSPTEQEEPDPAN
  LEVDHDFFQDKVWPHLALRVPAFETLKVQSAWAGYYDYNTFDQNGVVGPHPLVVNMYFATGFSGHGLQQAPGIGR
  AVAEMVLKGRFQTIDLSPFLFTRFYLGEKIQENNII

• Structural information:
  • Interpro: IPR006076  IPR036188  
  • STRING: ENSP00000263578
• Other Databases: GeneCards:  FOXRED1  Malacards:  FOXRED1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032981	mitochondrial respiratory chain complex I assembly	IBA	biological process
GO:0016491	oxidoreductase activity	IBA	molecular function
GO:0005747	mitochondrial respiratory chain complex I	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005747	mitochondrial respiratory chain complex I	IDA	colocalizes with
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0032981	mitochondrial respiratory chain complex I assembly	IMP	biological process
GO:0005747	mitochondrial respiratory chain complex I	IMP	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0070469	respirasome	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component

Diseases

Associated diseases	References
Mitochondrial complex I deficiency	KEGG:H00473
Leigh syndrome	KEGG:H01354
Mitochondrial complex I deficiency	KEGG:H00473
Leigh syndrome	KEGG:H01354
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881