• Gene id: 5557

Gene Summary

• Gene Symbol: PRIM1   Gene   UCSC   Ensembl
• Aliases: p49
• Gene name: DNA primase subunit 1
• Alternate names: DNA primase small subunit, DNA primase 1, DNA primase 49 kDa subunit, DNA primase subunit 48, primase (DNA) subunit 1, primase p49 subunit, primase polypeptide 1, 49kDa, primase, DNA, polypeptide 1 (49kDa),
• Gene location: 12q13.3 (56752322: 56731579)     Exons: 13     NC_000012.12
• Gene summary(Entrez): The replication of DNA in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which DNA polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, s
• OMIM: 600655

Protein Summary

• Protein general information: P49642  
  • Name: DNA primase small subunit (EC 2.7.7. ) (DNA primase 49 kDa subunit) (p49)
  • Length: 420  
  • Mass: 49902
• Sequence:

  METFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKMNP
  YKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDF
  GFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEE
  YALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQY
  CFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAISTNEEEKEENEAESD
  VKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF

• Structural information:
  • Interpro: IPR002755  IPR014052  
  • CDD: cd04860
  • PDB: 4BPU 4BPW 4BPX 4LIK 4LIL 4MHQ 4RR2 5EXR 6R4S 6R4T 6R4U 6R5D 6R5E 6RB4
  • PDBsum: 4BPU 4BPW 4BPX 4LIK 4LIL 4MHQ 4RR2 5EXR 6R4S 6R4T 6R4U 6R5D 6R5E 6RB4
  • STRING: ENSP00000350491
• Other Databases: GeneCards:  PRIM1  Malacards:  PRIM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003697	single-stranded DNA binding	IBA	molecular function
GO:0003896	DNA primase activity	IBA	molecular function
GO:0005658	alpha DNA polymerase:primase complex	IBA	cellular component
GO:0006269	DNA replication, synthesis of RNA primer	IBA	biological process
GO:0006269	DNA replication, synthesis of RNA primer	IEA	biological process
GO:0003896	DNA primase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0006269	DNA replication, synthesis of RNA primer	IEA	biological process
GO:0006260	DNA replication	IEA	biological process
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0003899	DNA-directed 5'-3' RNA polymerase activity	IEA	molecular function
GO:0003896	DNA primase activity	TAS	molecular function
GO:0006269	DNA replication, synthesis of RNA primer	TAS	biological process
GO:0006270	DNA replication initiation	TAS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0032201	telomere maintenance via semi-conservative replication	TAS	biological process
GO:0032201	telomere maintenance via semi-conservative replication	TAS	biological process
GO:0032201	telomere maintenance via semi-conservative replication	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03030	DNA replication

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881