• Gene id: 55554

Gene Summary

• Gene Symbol: KLK15   Gene   UCSC   Ensembl
• Aliases: ACO, HSRNASPH
• Gene name: kallikrein related peptidase 15
• Alternate names: kallikrein-15, ACO protease, kallikrein-like serine protease, prostinogen,
• Gene location: 19q13.33 (50834336: 50825288)     Exons: 4     NC_000019.10
• Gene summary(Entrez): Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one
• OMIM: 610601

Protein Summary

• Protein general information: Q9H2R5  
  • Name: Kallikrein 15 (EC 3.4.21. ) (ACO protease)
  • Length: 256  
  • Mass: 28087
  • Tissue specificity: Highest expression in the thyroid gland. Also expressed in the prostate, salivary, and adrenal glands and in the colon testis and kidney. {ECO
• Sequence:

  MWLLLTLSFLLASTAAQDGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAHCQSRFMRVRLGEH
  NLRKRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNPQVRPAVLPTRCPHPGEACVVSGWGLVSHNE
  PGTAGSPRSQVSLPDTLHCANISIISDTSCDKSYPGRLTNTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSW
  GDVPCDNTTKPGVYTKVCHYLEWIRETMKRN

• Structural information:
  • Protein Domains: (22..25-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR009003  IPR001314  IPR001254  IPR018114  
  • Prosite: PS50240 PS00134
  • CDD: cd00190
  • STRING: ENSP00000469315
• Other Databases: GeneCards:  KLK15  Malacards:  KLK15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030141	secretory granule	IBA	cellular component
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0004252	serine-type endopeptidase activity	NAS	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)