• Gene id: 55544

Gene Summary

• Gene Symbol: RBM38   Gene   UCSC   Ensembl
• Aliases: HSRNASEB, RNPC1, SEB4B, SEB4D, dJ800J21.2
• Gene name: RNA binding motif protein 38
• Alternate names: RNA-binding protein 38, CLL-associated antigen KW-5, RNA-binding region (RNP1, RRM) containing 1, RNA-binding region-containing protein 1, ssDNA-binding protein SEB4,
• Gene location: 20q13.31 (57391395: 57409332)     Exons: 6     NC_000020.11

Protein Summary

• Protein general information: Q9H0Z9  
  • Name: RNA binding protein 38 (CLL associated antigen KW 5) (HSRNASEB) (RNA binding motif protein 38) (RNA binding region containing protein 1) (ssDNA binding protein SEB4)
  • Length: 239  
  • Mass: 25498
• Sequence:

  MLLQPAPCAPSAGFPRPLAAPGAMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSR
  GYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSLQTGFAIGVQQLHPTLIQRTYGLTPHYIYPPAI
  VQPSVVIPAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTF
  VQYQAPQLQPDRMQ

• Structural information:
  • Protein Domains: (34..11-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012677  IPR035979  IPR000504  
  • Prosite: PS50102
  • PDB: 2CQD 6JVX 6JVY
  • PDBsum: 2CQD 6JVX 6JVY
  • STRING: ENSP00000348538
• Other Databases: GeneCards:  RBM38  Malacards:  RBM38

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0051252	regulation of RNA metabolic process	IBA	biological process
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0003729	mRNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006397	mRNA processing	IBA	biological process
GO:0070935	3'-UTR-mediated mRNA stabilization	IBA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0003730	mRNA 3'-UTR binding	IBA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010830	regulation of myotube differentiation	IEA	biological process
GO:0003729	mRNA binding	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0043484	regulation of RNA splicing	IDA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq