• Gene id: 55532

Gene Summary

• Gene Symbol: SLC30A10   Gene   UCSC   Ensembl
• Aliases: HMDPC, HMNDYT1, ZNT10, ZNT8, ZRC1, ZnT-10
• Gene name: solute carrier family 30 member 10
• Alternate names: zinc transporter 10, manganese transporter SLC30A10, zinc transporter 8,
• Gene location: 1q41 (219959097: 219910394)     Exons: 6     NC_000001.11
• Gene summary(Entrez): This gene is highly expressed in the liver and is inducible by manganese. Its protein product appears to be critical in maintaining manganese levels, and has higher specificity for manganese than zinc. Loss of function mutations appear to result in a pleo
• OMIM: 611146

Protein Summary

• Protein general information: Q6XR72  
  • Name: Zinc transporter 10 (ZnT 10) (Manganese transporter SLC30A10) (Solute carrier family 30 member 10)
  • Length: 485  
  • Mass: 52684
  • Tissue specificity: Specifically expressed in fetal liver and fetal brain (PubMed
• Sequence:

  MGRYSGKTCRLLFMLVLTVAFFVAELVSGYLGNSIALLSDSFNMLSDLISLCVGLSAGYIARRPTRGFSATYGYA
  RAEVVGALSNAVFLTALCFTIFVEAVLRLARPERIDDPELVLIVGVLGLLVNVVGLLIFQDCAAWFACCLRGRSR
  RLQQRQQLAEGCVPGAFGGPQGAEDPRRAADPTAPGSDSAVTLRGTSVERKREKGATVFANVAGDSFNTQNEPED
  MMKKEKKSEALNIRGVLLHVMGDALGSVVVVITAIIFYVLPLKSEDPCNWQCYIDPSLTVLMVIIILSSAFPLIK
  ETAAILLQMVPKGVNMEELMSKLSAVPGISSVHEVHIWELVSGKIIATLHIKYPKDRGYQDASTKIREIFHHAGI
  HNVTIQFENVDLKEPLEQKDLLLLCNSPCISKGCAKQLCCPPGALPLAHVNGCAEHNGGPSLDTYGSDGLSRRDA
  REVAIEVSLDSCLSDHGQSLNKTQEDQCYVNRTHF

• Structural information:
  • Interpro: IPR002524  IPR027469  
  • STRING: ENSP00000355893
• Other Databases: GeneCards:  SLC30A10  Malacards:  SLC30A10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005385	zinc ion transmembrane transporter activity	IBA	molecular function
GO:0006882	cellular zinc ion homeostasis	IBA	biological process
GO:0071577	zinc ion transmembrane transport	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0006828	manganese ion transport	IBA	biological process
GO:0071421	manganese ion transmembrane transport	IDA	biological process
GO:1903427	negative regulation of reactive oxygen species biosynthetic process	IDA	biological process
GO:0071579	regulation of zinc ion transport	IDA	biological process
GO:0055037	recycling endosome	IDA	cellular component
GO:0071579	regulation of zinc ion transport	IDA	biological process
GO:1905802	regulation of cellular response to manganese ion	IDA	biological process
GO:2000773	negative regulation of cellular senescence	IDA	biological process
GO:1904385	cellular response to angiotensin	IDA	biological process
GO:0005769	early endosome	IDA	cellular component
GO:0007173	epidermal growth factor receptor signaling pathway	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0006828	manganese ion transport	IMP	biological process
GO:0043524	negative regulation of neuron apoptotic process	IMP	biological process
GO:0006828	manganese ion transport	IMP	biological process
GO:0006812	cation transport	IEA	biological process
GO:0008324	cation transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006829	zinc ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005384	manganese ion transmembrane transporter activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0055037	recycling endosome	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Hypermanganesemia with dystonia	KEGG:H01938
Hypermanganesemia with dystonia	KEGG:H01938
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray