• Gene id: 5553

Gene Summary

• Gene Symbol: PRG2   Gene   UCSC   Ensembl
• Aliases: BMPG, MBP, MBP1, proMBP
• Gene name: proteoglycan 2, pro eosinophil major basic protein
• Alternate names: bone marrow proteoglycan, eosinophil granule major basic protein, eosinophil major basic protein, natural killer cell activator, proteoglycan 2 preproprotein, proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein),
• Gene location: 11q12.1 (57390649: 57386779)     Exons: 6     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is the predominant constituent of the crystalline core of the eosinophil granule. High levels of the proform of this protein are also present in placenta and pregnancy serum, where it exists as a complex with several other
• OMIM: 615692

Protein Summary

• Protein general information: P13727  
  • Name: Bone marrow proteoglycan (BMPG) (Proteoglycan 2) [Cleaved into: Eosinophil granule major basic protein (EMBP) (MBP) (Pregnancy associated major basic protein)]
  • Length: 222  
  • Mass: 25206
  • Tissue specificity: High levels of the proform in placenta and pregnancy serum; in placenta, localized to X cells of septa and anchoring villi. Lower levels in a variety of other tissues including kidney, myometrium, endometrium, ovaries, breast, prostate
• Sequence:

  MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVE
  SISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVS
  ALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY

• Structural information:
  • Protein Domains: (104..22-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040"-)
  • Interpro: IPR001304  IPR016186  IPR018378  IPR016187  IPR033816   IPR002352  
  • Prosite: PS00615 PS50041
  • CDD: cd03598
  • PDB: 1H8U 2BRS 4QXX
  • PDBsum: 1H8U 2BRS 4QXX
  • STRING: ENSP00000312134
• Other Databases: GeneCards:  PRG2  Malacards:  PRG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006955	immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0042742	defense response to bacterium	IEA	biological process
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0030246	carbohydrate binding	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0030021	extracellular matrix structural constituent conferring compression resistance	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0030021	extracellular matrix structural constituent conferring compression resistance	RCA	molecular function
GO:0030021	extracellular matrix structural constituent conferring compression resistance	HDA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0030133	transport vesicle	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05310	Asthma

Diseases

Associated diseases	References
Asthma	PMID:22022864
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881