• Gene id: 55529

Gene Summary

• Gene Symbol: PIP4P2   Gene   UCSC   Ensembl
• Aliases: TMEM55A
• Gene name: phosphatidylinositol-4,5-bisphosphate 4-phosphatase 2
• Alternate names: type 2 phosphatidylinositol 4,5-bisphosphate 4-phosphatase, PtdIns-4,5-P(2) 4-phosphatase type II, ptdIns-4,5-P2 4-Ptase II, transmembrane protein 55A, type 2 PtdIns-4,5-P2 4-Ptase, type II PtdIns-4,5-P(2) 4-phosphatase, type II phosphatidylinositol 4,5-bisphos,
• Gene location: 8q21.3 (91040895: 90993801)     Exons: 8     NC_000008.11
• Gene summary(Entrez): TMEM55A catalyzes the degradation of phosphatidylinositol 4,5-bisphosphate (PtdIns-4,5-P2) by removing the 4-phosphate (Ungewickell et al., 2005 [PubMed 16365287]).[supplied by OMIM, Mar 2008]
• OMIM: 192130

Protein Summary

• Protein general information: Q8N4L2  
  • Name: Type 2 phosphatidylinositol 4,5 bisphosphate 4 phosphatase (Type 2 PtdIns 4,5 P2 4 Ptase) (EC 3.1.3.78) (PtdIns 4,5 P2 4 Ptase II) (Transmembrane protein 55A)
  • Length: 257  
  • Mass: 28081
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MAADGVDERSPLLSASHSGNVTPTAPPYLQESSPRAELPPPYTAIASPDASGIPVINCRVCQSLINLDGKLHQHV
  VKCTVCNEATPIKNPPTGKKYVRCPCNCLLICKDTSRRIGCPRPNCRRIINLGPVMLISEEQPAQPALPIQPEGT
  RVVCGHCGNTFLWMELRFNTLAKCPHCKKISSVGSALPRRRCCAYITIGMICIFIGVGLTVGTPDFARRFRATYV
  SWAIAYLLGLICLIRACYWGAIRVSYPEHSFA

• Structural information:
  • Interpro: IPR019178  
  • STRING: ENSP00000285419
• Other Databases: GeneCards:  PIP4P2  Malacards:  PIP4P2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050765	negative regulation of phagocytosis	ISS	biological process
GO:0030670	phagocytic vesicle membrane	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0034597	phosphatidylinositol-4,5-bisphosphate 4-phosphatase activity	IEA	molecular function
GO:0046856	phosphatidylinositol dephosphorylation	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0034597	phosphatidylinositol-4,5-bisphosphate 4-phosphatase activity	IDA	molecular function
GO:0031902	late endosome membrane	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0046856	phosphatidylinositol dephosphorylation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050765	negative regulation of phagocytosis	IEA	biological process
GO:0031902	late endosome membrane	IEA	cellular component
GO:0046856	phosphatidylinositol dephosphorylation	IEA	biological process
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030670	phagocytic vesicle membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04070	Phosphatidylinositol signaling system

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray