• Gene id: 5552

Gene Summary

• Gene Symbol: SRGN   Gene   UCSC   Ensembl
• Aliases: PPG, PRG, PRG1
• Gene name: serglycin
• Alternate names: serglycin, hematopoetic proteoglycan core peptide, hematopoetic proteoglycan core protein, hematopoietic proteoglycan core protein, p.PG, platelet proteoglycan core protein, proteoglycan 1, secretory granule, proteoglycan protein core for mast cell secretory gra,
• Gene location: 10q22.1 (69057532: 69104810)     Exons: 1     NC_000010.11
• Gene summary(Entrez): This gene encodes a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydroly
• OMIM: 177040

Protein Summary

• Protein general information: P10124  
  • Name: Serglycin (Hematopoietic proteoglycan core protein) (Platelet proteoglycan core protein) (P.PG) (Secretory granule proteoglycan core protein)
  • Length: 158  
  • Mass: 17652
• Sequence:

  MMQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLF
  PKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQH
  GLEEDFML

• Structural information:
  • Interpro: IPR007455  
  • STRING: ENSP00000242465
• Other Databases: GeneCards:  SRGN  Malacards:  SRGN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030141	secretory granule	IBA	cellular component
GO:0030502	negative regulation of bone mineralization	IBA	biological process
GO:0033363	secretory granule organization	IBA	biological process
GO:0031214	biomineral tissue development	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0099175	regulation of postsynapse organization	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0050710	negative regulation of cytokine secretion	IEA	biological process
GO:0042629	mast cell granule	IEA	cellular component
GO:0033382	maintenance of granzyme B location in T cell secretory granule	IEA	biological process
GO:0033371	T cell secretory granule organization	IEA	biological process
GO:0033364	mast cell secretory granule organization	IEA	biological process
GO:0016485	protein processing	IEA	biological process
GO:0099091	postsynaptic specialization, intracellular component	IEA	cellular component
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0033373	maintenance of protease location in mast cell secretory granule	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0030502	negative regulation of bone mineralization	IDA	biological process
GO:0008626	granzyme-mediated apoptotic signaling pathway	IDA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0050710	negative regulation of cytokine secretion	ISS	biological process
GO:0042629	mast cell granule	ISS	cellular component
GO:0033373	maintenance of protease location in mast cell secretory granule	ISS	biological process
GO:0033382	maintenance of granzyme B location in T cell secretory granule	ISS	biological process
GO:0033371	T cell secretory granule organization	ISS	biological process
GO:0033364	mast cell secretory granule organization	ISS	biological process
GO:0016485	protein processing	ISS	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881